Conserved Protein Domain Family
DUF2083

?
pfam09856: DUF2083 
Predicted transcriptional regulator (DUF2083)
This domain is found in various prokaryotic transcriptional regulatory proteins belonging to the XRE family. Its exact function is, as yet, unknown.
Statistics
?
PSSM-Id: 401717
View PSSM: pfam09856
Aligned: 108 rows
Threshold Bit Score: 176.557
Threshold Setting Gi: 122544624
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012567841        317 TLQRPGAKGVPFFFLRIDNAGNISKRFSAlPAFHFARFGSACPRWNVHDAFRMPGAIQTQLAQLADGTVYFSVSRRVVKA 396 Rhodospi...
zuci:PHZ_c3209      319 TLARPGARGVPFFMVRVDSAGNISKRFAG-GNFPFSRFGGACPRWNVHSSFRTPGRIVTQIIETPDGQRYFTLSRTVSRI 397 Phenylob...
Q9A7G0              289 TLGRAGSRGVPFFMMRLDAAGNISKRFAA-GPFPFSRFGGACPRWNVHDSFKTPGRIVTQVIETPDGERYFTLSRTVRRT 367 Caulobac...
jgi:Bresu_1694      315 TLSRPTARGVPFFLMRVDQAGNVSKRYAA-GAFPFARFGGACPRWRLHSAFRTPGRLVTQIIETPDGRRWFTLARTVDRQ 393 Brevundi...
jgi:Astex_0454      312 TLSQPGRRGVPFFMMRIDSAGNVSKRFAA-GRFPFSRFGGACPRWNLHQAFQSPGRILTQVIETPDKARYFTLARTLDRG 390 Asticcac...
BAK65607            312 TLQRAGEEGVPFFFIRLDAAGNVSKRLDG-AGFPFARHGGACPLWTVHSVFQTPGRIVTQRLELPDGERFFSIARTVSAG 390 Sphingob...
goetting:NGR_c14320 308 TLQKPGQERVPFFFIRVDAAGNVSKRLDS-ANFPFARHGGGCPLWTLHQVFTTPRAVVTQWLELPDGQRFFSIARTVSSG 386 Sinorhiz...
CCA92695            305 TMHRPGEERVPFFFIRVDEAGNVSKRLDG-AGFPFAAHGGGCPLWNVHQVFRRPGEIQTQWLELPDGQRFFSIARTVTSG 383 Novosphi...
Q6N1L0              317 TLQRPNARGVPFFMLRVDNAGNVSKRFSS-GTFPFSKFGGTCPLWNVHSTFDTPDRLLKQVIELPDGSRYFSIAQMVRRP 395 Rhodopse...
WP_012591524        319 TLSRETARGVPFFMLRIDIAGNVSKRLSP-RRFPLAQSGGACPLWNIHASFIEPNRILTQVVELTDGSQWFSIARATQRP 397 Methyloc...
WP_012567841        397 GGGW-KNPARQFAIALGTDIAHAGQLVYADGVDLhNKAAATPIGVNCRLCPRLDCTQRAFPPLNHRLEVDENIRGLSSY 474 Rhodospir...
zuci:PHZ_c3209      398 ATPY-AGDDAELAIGMGCELKYAERLVYSRGLDL-KEPVATGIGPACRICERPACPQRAAEPISRTLTVDDFTKSISPY 474 Phenyloba...
Q9A7G0              368 SGLQ-AGLEDELVVGLGCELKYASKLVHARGLDI-ANPIAVEIGPSCRICERPACPQRAAAPINRTLMVEETSKALSPF 444 Caulobact...
jgi:Bresu_1694      394 GHDG-FGERYDLAIGLGCELKDAHRLVHARGLDL-AAPDVTPIGPACRLCHRHPCAERAAPPVDRVLAVDDWSKSVSPY 470 Brevundim...
jgi:Astex_0454      391 LRGWdGGAYSEQALGLGCELKYAEKLVYAKGLDL-NTPAAVETGPMCRLCERPNCRERAAPPVTKTLSVDEWIKSATAF 468 Asticcaca...
BAK65607            391 GGAW-GAPVMSRAVALACAEEHISLLVYGEGA---AAMAPTPIGIACHLCHRPRCLARAAPPLGRDLRSDDYRDTGIPF 465 Sphingobi...
goetting:NGR_c14320 387 GGAF-GVPRVTRAVALVCEAGYAERMVYYRHDv--QPVTPTPIGIACRLCHRTNCTSRSEPPIGRHISPDDYRRTDTPF 462 Sinorhizo...
CCA92695            384 RGRY-GRPQVMRAVALACAAEEAGRLVYAAGV-EpNEAPGTPIGVTCRLCHRAECVARAVPPIGRDILADDYRRAAQPY 460 Novosphin...
Q6N1L0              396 IAPH-PQPQPRFAIGLGCEIRHASKLIYAAGMDL-EKAEGTPIGVNCRLCEREHCSQRAEPPITRTLILDENTRRASSF 472 Rhodopseu...
WP_012591524        398 VAAW-GATQPRFAIVLGCELKYARQLIYAKSLDL-DAPEPTPIGLGCRQCERQNCPQRAAPPARRQLVVDESTRNVSPF 474 Methyloce...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap