Conserved Protein Domain Family
Yae1_N

?
pfam09811: Yae1_N 
Essential protein Yae1, N terminal
Members of this family are found in the N terminal region of the essential protein Yae1. Their exact function has not, as yet, been determined. The family DUF1715, pfam08215 has now been merged into this family.
Statistics
?
PSSM-Id: 401679
View PSSM: pfam09811
Aligned: 64 rows
Threshold Bit Score: 31.6219
Threshold Setting Gi: 121971339
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2NWZ9  55 GFKQGQQEGEKQGYRQGFDQGRSAGFDQGLQDAQAEQGQ 93  Sodalis glossinidius str. 'morsitans'
Q6FUV0  37 GYLDGIVSAKEENLQDGFDMSFPLGAELGLRVGKIIGRL 75  [Candida] glabrata CBS 138
Q6CV86  39 GYLDGISSAKEENLQAGFDDTFPLGAKYGFQIGEIVGKL 77  Kluyveromyces lactis NRRL Y-1140
Q753A3  38 GYRDGISSAKEENLQEGFDMKFPEGSRLGFQVGEVIGKL 76  Eremothecium gossypii ATCC 10895
Q9P840  68 GYVDGITQAKESSLQQGFDDGYPEGAKLGIKVGEILANL 106 Candida albicans SC5314
A5E625  82 GYVDGLAKHQEENLQKGFDFAYSIGADLGIKVGRLLARA 120 Lodderomyces elongisporus NRRL YB-4239
A5DLN4  65 GYVDGLAHAQESSLQAGFDEGYGTGAGLGVAVGSILAKT 103 Meyerozyma guilliermondii ATCC 6260
A3LWJ7  48 GYLDGLASAQESSLQSGFDKAFSDGARMGAAVGKILGEL 86  Scheffersomyces stipitis CBS 6054
Q6BL68  60 GYLDGITSAKESSLQDGFDDSFPKGAELGIIVGNILGSL 98  Debaryomyces hansenii CBS767
Q17KQ0  28 GYAEGLADGRETIYQKDFDRGYRIGFTMAFKLAQYQGFA 66  yellow fever mosquito
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap