Conserved Protein Domain Family
ELP6

?
pfam09807: ELP6 
Elongation complex protein 6
ELP6 is a subunit of the RNA polymerase II elongator complex. The Elongator complex promotes RNA-polymerase II transcript elongation through histone acetylation in the nucleus and tRNA modification in the cytoplasm. ELP5 and ELP6 play a major role in the migration, invasion and tumorigenicity of melanoma cells, as integral subunits of Elongator
Statistics
?
PSSM-Id: 401676
View PSSM: pfam09807
Aligned: 17 rows
Threshold Bit Score: 306.177
Threshold Setting Gi: 470304976
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004078402   2 FTELNSILNTSPESFTPGEFILLSDRQSDASFLIHHFLSFYLKARCKVCFVALVQSFSHYHAVSQRLGVSLTQAKEKGQL 81  Japanese medaka
Q0P424         2 FPELNSLLNASPDTFKPGDFILLSDRQADASFLIHHYLSFYLRAGCKVCFLGLVQSFSHYSAVGQRLGVSLTQAREKGQL 81  zebrafish
EKC35631       1 meDVNNVLDIAKDDNLYGEVITLADSTADGTFLIHHFLSFFLGNNRPVCFVSLSQSFGHHKSVCQKLGVSLTQKIESSHL 80  Pacific oyster
XP_002117123  44 FPELNSLLECNKKNLPNGKSLVIIDSQTDGSFLLHHFISLYIQGGGKVVMLAFAQSFSHYSSVAQKLGINLNSACDDKTF 123 Trichoplax adha...
XP_006010935   2 FAELNAILNSSPEKCAQENFVCVCDSKTDGSFLIHHFLSFYIKAGCKVCFVALVQSFSHYSIIAQKLGTNLGAAKERGQL 81  coelacanth
XP_003762242   2 FPELNNLLNVSPEKPEQGTFTLLCNNKTDGSFLVHHFLSFYLKANCKVCFVALLQSFSHYNIVGQKLGVNLIAARDRGQL 81  Tasmanian devil
ELV09690       2 FPELNNLLNTSPDRAEQGKLTLLCAAETDGSFLVHHFLSFYLKANCKVCFVALIQSFSHYNIVGQKLGVSLTAARERGQL 81  Chinese tree shrew
XP_002813850   2 FVELNNLLNTTPDRAEQGKLTLLCDAKTDGSFLVHHFLSFYLKANCKVCFVALIQSFSHYSIVGQKLGVSLTMARERGQL 81  Sumatran orangutan
Q28CX0         2 FPELNSLLGAGTDTVERGKFTLLCDSKTDGSFLVHHFLSYYLRAGCRVCFVALVQSFSHYSIVAQKLGVNLSSAKDEGQL 81  tropical clawed...
NP_001264419   2 LEELNELLDATPQRPDTGKFTLLRDSRTDGSFLVHHFLSFYLRAGCKVCFLALVQSFSHYNIVAQKLGVSLTAAKERGQL 81  chicken
XP_004078402  82 IFLEGLKESLSVFLPQE-ENAGHQAMSFL-RDPAAGLRSLYEFVQSSVVESSGgggasaEQWGPPVLLMDDVSVLLSLGV 159 Japanese medaka
Q0P424        82 VFLEGLKDSIGAILKED-TSEGTQALSYL-RSPRAGLEGLFRFVESSLCQS--------GDDGPPVLIIDDLSVLLSLGV 151 zebrafish
EKC35631      81 NFFDGLKVFGNRFLDTQpEN--------VdISNTTSLQGFYKAIKTNYEDLQD------KNKAPPVVIVDSLNVLLNIGY 146 Pacific oyster
XP_002117123 124 VFLPGLKYTLDGIINRDvENPL------LdTSNCKSLHSLYQAINSAISANE-------NQSLPTLLIIDDISTLLYLGF 190 Trichoplax adha...
XP_006010935  82 VFLEGLKSSVDILFSEEpRSAQPHPFQFIsNTGED-LKSLYHCIQTSLSQTDS------STWKFPVLIVDDLSVLLSLGV 154 coelacanth
XP_003762242  82 VFLEGLKSTVEILFGSE---EQPNTLKFFrESDTD-LKSLFELVHKALTPSGDgd---aASWKFPVLLVDDLSVLLSLGV 154 Tasmanian devil
ELV09690      82 VFLEGLKSSVDVFFQAQ---EKTHPLHFLrEANAGNLQPLYEFVQEALKPVDSg----aAAWRCPVLLVDDLSVLLSLGV 154 Chinese tree shrew
XP_002813850  82 VFLEGLKSAVDVVFQAQ---KEPQPLQFLrEANAGNLKPLFEFVREALKPVDSg----eARWTYPVLLVDDLSVLLSLGM 154 Sumatran orangutan
Q28CX0        82 VFLEGLRSYTDLLFGDNpEAEVTNPLCFLrAGSD--LKPLYSFVSAALAPSAG------QSWKCPVLILDDVSVLLSLGV 153 tropical clawed...
NP_001264419  82 VFLEGLKSCLDLVFGEEePSGQPSPLQFIsGSVSN-LKDLFDFVRTSLAPTDS------DSWKGRVLLVDDLSVLLSLGA 154 chicken
XP_004078402 160 RVGAVLDFSHY---------CRTTVCSQLQ--------------GNVVMLVRCDGEAEEDDADdegseQLMRGLTHQSCL 216 Japanese medaka
Q0P424       152 SAGAILDFTLY---------CRATVCSELQ--------------GNMVILVRCEEEDADDDEEgl--nLLQRGLVHQCHL 206 zebrafish
EKC35631     147 QVKEISAFVQYlchlisgpgCDAR--------------------GTLITFLSIGENGLDEEAS-----LLWRSVVHMSNM 201 Pacific oyster
XP_002117123 191 QHTEICTFLTY---------CQHTVCKKTN--------------GCILSLIHNDSDVEDQSSN-----LLSRWFHHFADI 242 Trichoplax adha...
XP_006010935 155 NVVNVLDFIHY---------CRATICSKLK--------------GTVVTLAHSDEDIGDEEME-----LIAKLLSHQSSL 206 coelacanth
XP_003762242 155 RAVAVLDFIQS---------CRATVCWQLK--------------GNVVALVHDSDKTEDEENA-----LLMNALGHQSSL 206 Tasmanian devil
ELV09690     155 GAVAVLDFVHY---------CRATVCSELKvpraagsqpgpqgpGHAQAYVH-----------------------HQSHL 202 Chinese tree shrew
XP_002813850 155 GAVAVLDFIHY---------CRATVCWELK--------------GNMVVLVHDSGDAEDEEND-----ILLNGLSHQSHL 206 Sumatran orangutan
Q28CX0       154 PPLQLLDFMHY---------CRATVCTQYQ--------------GNVVCLVHGAEESGDEEKE-----LLRRSLSHQSQV 205 tropical clawed...
NP_001264419 155 APVDVLDFIHY---------CRMVVCSQLK--------------GNIVVLVHGSEDSEDEENK-----LVVTSLCHHSNL 206 chicken
XP_004078402 217 TLHVQGLPTGYCRDIHGQVEFCWKKRQS---DGQHAPKKVFQFKVHD 260 Japanese medaka
Q0P424       207 ALHVEGLPTGYCRDIHGQMEVWWRQGE----NDAYNQRKIFQFKVHD 249 zebrafish
EKC35631     202 DVLVSGLESGYCKDVHGKIEVKRRN------LLKKNSQKTMQFKVND 242 Pacific oyster
XP_002117123 243 VLELEGLQSGRSKDVHGQLKVVFTRREQndlHSLSPLSRCVHYRIRD 289 Trichoplax adhaerens
XP_006010935 207 MLKLEGLATGYCKDVHGEIKITWRGASHi--KPQKNITEVYQYKIQD 251 coelacanth
XP_003762242 207 ILRAEGLLTGFCKDVHGQLKILWRGLQQp--KAEQTRSLIYQYKIQD 251 Tasmanian devil
ELV09690     203 VLRAEGLATGFCKDVHGQLRILWRASQP---TAQRGRSLTFQYKIQD 246 Chinese tree shrew
XP_002813850 207 ILRAEGLATGFCRDVHGQLRILWRRPSQs--TAQRDQSFTYQYKIQD 251 Sumatran orangutan
Q28CX0       206 ILWAEGLSSGFCKEVHGQLKIFRGAVSSg-kKRGQTQPEIYQYKIQD 251 tropical clawed frog
NP_001264419 207 ILWVQGLATGFCKDVHGEIKIIKRLSLE---STEQDVIQIYQYKIQD 250 chicken
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap