Conserved Protein Domain Family
SYS1

?
pfam09801: SYS1 
Integral membrane protein S linking to the trans Golgi network
Members of this family are integral membrane proteins involved in protein trafficking between the late Golgi and endosome. They may also serve as a receptor for ADP-ribosylation factor-related protein 1 (ARFRP1). Sys1p is a small integral membrane protein with four predicted transmembrane domains that localizes to the Trans Golgi network TGN in yeast and human cells.
Statistics
?
PSSM-Id: 370705
View PSSM: pfam09801
Aligned: 25 rows
Threshold Bit Score: 139.296
Threshold Setting Gi: 74832253
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7S576  11 GALTELPPLKILSQIAALQAIYYTAALVLMFFTAAVAGNPFTLDLVFGWEAVRGDNTQGWLNGFIWCLVgGLVLPLSLTA 90  Neurospora crassa
Q8I7G0   4 FRQFVWDPVLLVSQMTCLQTFFYATQTSVM-LFCSFFGYEPLISSIFSIQ-------TQRSMALIQLVS-AVGVSFALSH 74  Caenorhabditis elegans
Q55E69   3 YKYNAWDPKLIIGQILSIQCLYYILLAGILYLLDSMFSSSLSLEQMFEYQSINTHSQSGRVVMTAFLIN-SLFGSFCLKY 81  Dictyostelium discoideum
Q9SSD6   3 YGTAVWDPWLIVGQIICLQCSYYLTLGLFTMVFLGLRVPRLSLVYFFDYATLTTSTFTGWSVIASFLFS-SLAGAVYMIF 81  thale cress
Q7PYJ7   5 FRNTQWDPYLLVAQIVAMQALLYVSLGTIMYVMDFFAEANHTLDHIFEYHEIHVTDLGGRLVIVAFILN-SLVGAGLLWF 83  Anopheles gambiae str...
Q1HPQ8  11 FRYTQWDPCLIIFQIVAMQSVMYLSLSLLVAIMQDLTGSTRTLDHLFEYHELHIVDNEGRAVILAFVFN-AVIGAFALWM 89  domestic silkworm
Q9VHP1   6 FRNTQWDPTLLSSQIVSMQFCVYFTLGLLVFVANKLSGDNYSLDHLFEYHEIHIYDMGGRLVICAFVLN-AFLASLALWC 84  fruit fly
A7S6Y0   5 FRTNVWDPVLIISQIIAIQCTFYISLGVWVLIVDYWSGSIHSLDQFFAYKELDISSLKGKLLMIAFCLN-SLTGAMALWF 83  starlet sea anemone
Q1RMQ3   5 FRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDGLVHSSPSLDQVFDAEILGFSTPPGRLSTMSFVLN-ALTCALGLLY 83  cattle
Q28EU0   5 FRSYIWDPVLIISQILLMQLIYYSCLGLWIAVLDLVVHYSPSLDQIFNCGILGFSSVPGRVSMMAFILN-SLTCALGLLY 83  tropical clawed frog
Q7S576  91 IVQRSKLILDFALTTHFIHLVIVTLYTtpdHTLPrHTAWWLTMAISSLASFLLGSWGCRYRELQPIAF 158 Neurospora crassa
Q8I7G0  75 LVQRAKQCLDFACTVHFFHLIFTTIYN---HALPtQFTWWILQVISTTVCTVLGEYLCMRIESQEIKL 139 Caenorhabditis elegans
Q55E69  82 IVERSKKCLDHSATVTFIHFIIVWIV----SGFPkTVVWWAIQLIGMVIMAMIGEYLCMRKELMDIPL 145 Dictyostelium discoideum
Q9SSD6  82 LVERARKCLDFSATLYIIHLFFCIMY----GGWPsSMAWWVVNGTGLAVMALLAEYLCIKREQREIPM 145 thale cress
Q7PYJ7  84 VVRRTKLCLDFSFTFHFTHLVICWWYN---EAFPsTIGWWMLNAVCAALMCVCSEFLCLKTELKEIPV 148 Anopheles gambiae str. PEST
Q1HPQ8  90 IVGRTKLCLDFSCTYHGLHLIACWYYN---GSFPtTFSWWTLNIACGAIMCVAGEFLCLRTELQAIPL 154 domestic silkworm
Q9VHP1  85 IVRRAKLCLDFSCTFHVLHLLICWWYN---RSFPaNASWWLLNVITGTIMCIGGEFLCLQTEMKEIPV 149 fruit fly
A7S6Y0  84 IVKRAKQCLDFTTTAHIVHLVFCCIY----AGFPfSWTWWLLNIICLALMAVIGEFVCMKTELKAIKV 147 starlet sea anemone
Q1RMQ3  84 FIRRGKQCLDFTVTVHFFHLLGCWLYS---SRFPsALTWWLVQAVCIALMAVIGEYLCMRSELKEIPL 148 cattle
Q28EU0  84 FIRRGKQCLDFTVTVHLFHLFGCWIYT---SQLPsSFTWWLLNVVCIALMAVIGEYLCMRTELREIPL 148 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap