6GIQ


Conserved Protein Domain Family
QCR10

?
pfam09796: QCR10 
Ubiquinol-cytochrome-c reductase complex subunit (QCR10)
The QCR10 family of proteins are a component of the ubiquinol-cytochrome c reductase complex (also known as complex III or cytochrome b-c1 complex). This complex is located on the inner mitochondrial membrane and it couples electron transfer from ubiquinol to cytochrome. This subunit (QCR10) is required for stable association of the iron-sulfur protein with the complex.
Statistics
?
PSSM-Id: 401668
View PSSM: pfam09796
Aligned: 96 rows
Threshold Bit Score: 57.4856
Threshold Setting Gi: 312210409
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6GIQ_U       15 FGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQDTLYKKIPLLGPTLEDHTPPEDKP 76 
EKD01705     14 FGGLTPELLRPFRSSLIGWGVTAGVAVSLFMSPVPLFQKDVLQKIPFLAPYFTDNTPESDKP 75  Trichosporon asahii var. asahii CB...
Q5K8J0       12 FAGITPERLRFWGTSAAVWGVAAGAAVSFYLSEVPIFQKDVLIKVPVVGSYFKDTTPDSDKP 73  Cryptococcus neoformans
ESK92889     11 pvqhTLSVASRWAPSLGMWGAGAGAAAVLFLSVTPLFKREVLIKVPVLGNYFEDKTPASDKP 72  Moniliophthora roreri MCA 2997
XP_001830611 12 paqaALSAAKPWTRSAGIWGFGTGAAVFLLLSVTPLVRREVLEKTPGLSWYFEDKTPASDKP 73  Coprinopsis cinerea okayama7#130
XP_001878628 11 plnaTLTVSRRWATSLGVWGVGAGTAALLLLSVTPLVKREVLVKVPVLGSYYEDKTPACDKP 72  Laccaria bicolor S238N-H82
CBQ73931     18 VGRFTPTAVFKWAPTLALWGGAGAGAVMLFMSSVPIFKKDVLIKLPVIAPYFEDKTHPADNA 79  Sporisorium reilianum SRZ2
EGG05703     26 LMGITSQTVSKWIPTLGLWGAGVGCAVTLFASAIPRFQNDVLKNIPGVAGYYESKIPECDKP 87  Melampsora larici-populina 98AG31
OAV97390     22 LMGVTSSVLTRWAPILGIWGAGGAAFVTLAASSIPRFQEDVLKKIPGIASYYESTIPDCDKP 83  Puccinia triticina 1-1 BBBD Race 1
Q9P7E0       17 ISFITPERTMKTIPAFSRWAFAAVAGVFVFAMQVPKVKTTILQPIAFIGDHFKDKTPEEDKW 78  Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap