Conserved Protein Domain Family
Avl9

?
pfam09794: Avl9 
Transport protein Avl9
Avl9 is a protein involved in exocytic transport from the Golgi. It has been speculated that Avl9 could play a role in deforming membranes for vesicle fission and/or in recruiting cargo.
Statistics
?
PSSM-Id: 401666
View PSSM: pfam09794
Aligned: 21 rows
Threshold Bit Score: 436.688
Threshold Setting Gi: 74853932
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5R991        16 VLHIVVVGFHHKKGCQ-----------------VEFSYPplipgDGHDSHTLPEEWKYLPFLALPDGAHNYQEDTVFFHL 78  Sumatran orangutan
Q2H333        18 IPLVSVVDFHHARGPE-----------------VERWFGv----DEGHDPAAEYDWTLLPFMALSDGAHALTEDFSYFTL 76  Chaetomium glob...
XP_001268963   9 APIVMVIDFHHARGPE-----------------IELCIG-----EDGTDIATENDWSLLPFMALSDGAHASTEEFSYFTL 66  Aspergillus cla...
KIS68223     140 ILGIAVVDFNHLVGPQ-----------------IEYTYP-------KELQQDEDLVKSLPFLALPDGSHLSDEDFCYFHL 195 Ustilago maydis...
O13943        10 VLCLATIGFHHLRGPE-----------------IEHLFP--------ESMDFPKEWSILPFLSLPDGAHSSEKDFVYFTL 64  Schizosaccharom...
Q08D17        21 VLHIVVVGFHHKKGCQ-----------------VEFSYPslmpgEEHDSHILPEEWKYLPFLALPDGAHNFQEDTVFFHL 83  tropical clawed...
Q29HH8        10 ILHILVVGFHHKLGCQ-----------------VEFSHPpl-iaGSSGRNECPSGWKYLPTLALPDGSHNFVEDTVFFNL 71  Drosophila pseu...
Q17GP2         7 ILHILVVGFHHKKGCQ-----------------VEFSYPpl-iaGSEGKQECPSGWKYLPTLALPDGSHNFNKDFVCFNL 68  yellow fever mo...
XP_310874      7 VLHILVVGFHHKKGCQ-----------------VEFSYPpl-vaGTEGKGECPSGWKYLPTLALPDGSHNFSSDFVCFNL 68  Anopheles gambi...
CAF98729      13 VLHIVVVGFHHKKGCQhqkehspsadavssdwqVEFSYPplvpdEGHDSNVLPDEWRYLPFLALPDGAHNYQEDTVYFHL 92  spotted green p...
Q5R991        79 P---PRNGNGATVFGISCYRQIEAKALKVRQADITRETVQKSVCVLSKLP-LYGLLQAKLQLITHAYFEEKDFSQISILK 154 Sumatran orangutan
Q2H333        77 LrpaTSSAPATSLFGISCTRQMDASQLLNRPAEVTRSTVQKAVVVIADSPqHFGMLRERLSVVTKAWFLQREFTDVEILR 156 Chaetomium glob...
XP_001268963  67 RkkeTATEPATSLFGIACSRQIDSNLLLNRPSDVTRSTVQKAVVVITDTPqTVGQLREKLSVVTSAWFAQRDFSDTDILK 146 Aspergillus cla...
KIS68223     196 H---CSKLSPSTIFGISCNRQIAADALLKKGAEVTRSTVQKAIVVLAKQP-VFGPIREKLGIVTRAFFAQGDLANVDILV 271 Ustilago maydis...
O13943        65 ----PFPNDEGTVFGLSCTRQLNASSLKNIPSDVTRSSVQKAVVVITTSP-PFGHIKDNLDIVTNAYFSQGDFSNLDVLR 139 Schizosaccharom...
Q08D17        84 P---PRCGDQKTVYGVSCYRQIEAKALKVRQADVTRETVQKSVCVLSQLP-LYGLLQAKLQLITHAYFEEKDFSQISILK 159 tropical clawed...
Q29HH8        72 P---SLFEPAASIYGVSCYRQIRVEKLKIRTADVTRSTVQKSVCILSRQP-IYGYIEVKLALIADAFFDQGDFSCTELLV 147 Drosophila pseu...
Q17GP2        69 P---SLTDPHESIYGISCYRQIPVEKLKIRTAEMTRSTVQKAVCALLSIP-IYGYVEVKLSLIAHAFFEQGDFSCTDILV 144 yellow fever mo...
XP_310874     69 P---SLTDPEQSVYGISCYRQIALEEVRIRTADLTRSTVQKSVCTLLSLP-IYGYVEVKLSLIAQAFFEQGDFSATEILV 144 Anopheles gambi...
CAF98729      93 P---PLGGDKKCVYGVSCYRQIEAKALKVRQADVTRETVQKSVCVLSRVP-LYGLLQAKLQLITHAYFEEKDFSQISILK 168 spotted green p...
Q5R991       155 ELYEHM----NSSlGGASLEGSQ--VYLGL--SPRDLVLHFRHKVLILFKLILLEKKvlfyispvnklvgalmtvlslfp 226 Sumatran orangutan
Q2H333       157 RFQESLadekARG-LLHDDEDRD--QYLGL--SLRELVREFRWQTLVLLKCCLLQPK----------------------- 208 Chaetomium glob...
XP_001268963 147 KFREGLii-----sWEQNEASKD--QNLGL--SLREMIHEFKYQTLVLFKALLLQPKmlffgsrcerlcmiq-fslisli 216 Aspergillus cla...
KIS68223     272 DFHSTLei-gLQSgGMSEDRETV--MYMGT--SLRELVHKWRFKTLMLVKLLLLQRRvmffgypveqlcnyq-yslvsll 345 Ustilago maydis...
O13943       140 DFFHVLtr-----------kEQD--VHIALniNLKSFLCEWRQNALVLLKVLLLGKRilvydksaerlgnfq-ysllsli 205 Schizosaccharom...
Q08D17       160 ELYEHM----NGSlGGSAIEGSQ--LYLGL--SPRDLVLHFRHKILILFKLILLEKKvlfyvspvnrlvgalmtvlslfp 231 tropical clawed...
Q29HH8       148 KAYQQLna-cLLDdESRRP-LRH--FHVGL--SLREIVLHWRHKTLILFKLLLLQRRvvcfgspvrgmcvlilgmaslvp 221 Drosophila pseu...
Q17GP2       145 EAFEQQnaclYSMdPMVEL-APArlHFVGL--PLRDLVLKWRHKLLILYKLLMLQKRiicfgspvqptcalilgvvslhp 221 yellow fever mo...
XP_310874    145 KAYEQLna-cLVSlEPQEIgSTRl-HFVGV--PLRDLLLKWRHKILILFKLLLLQKRvicygspvhptcalilgiaslhp 220 Anopheles gambi...
CAF98729     169 ELYEHMn----GSlGGSALEGSQ--VYLGL--SPRDLILHFRHKVLILFKLILLEKKvlfyvspvsrlvgalmtvlslfp 240 spotted green p...
Q5R991       227 gmiehglsDCSqyrprksmsedgglqesnpcaddfvsastadvshtnlgtvrk--------------------viagnhg 286 Sumatran orangutan
Q2H333       209 --------DSA--------------------------------------------------------------------- 211 Chaetomium glob...
XP_001268963 217 pglinslqDCA--------------------------------------------------------------------- 227 Aspergillus cla...
KIS68223     346 pglllnlqDAG--------------------------------------------------------------------- 356 Ustilago maydis...
O13943       206 pcmmshlqDVS--------------------------------------------------------------------- 216 Schizosaccharom...
Q08D17       232 gmiehgltDSSqyrprksmsedieyplvtysddctslaasglnakqe--------------------------------n 279 tropical clawed...
Q29HH8       222 rllekgfqEVAcvrtsrplspmpdftdslqrealalaaaeaeaeaatqd---------------------------epkl 274 Drosophila pseu...
Q17GP2       222 ellskgfqEVAcvktsrpmspmpnfgtpldetqkfpseptspv------------------------------------- 264 yellow fever mo...
XP_310874    221 eliskgfqQVAcvktsrpmspmptfstpveeqhgdappcrttlpaivteqeaphepiapcreadelltdpdgrsiasake 300 Anopheles gambi...
CAF98729     241 gmiehglvDSSsyrprnslsedssleesvsgaeefvsvsvtdld------------------------------------ 284 spotted green p...
Q5R991       287 edaamkteeplfqvedsskgqepndtnqylkppsRPSPDSSESDweTLDPSVLEDPNSKEreqlgsdqtnlfpkdsvpse 366 Sumatran orangutan
Q2H333       212 ----------------------------------GPELDNYEKG--LSMPTSLRTSDRNS-------------------- 235 Chaetomium glob...
XP_001268963 228 ----------------------------------DPSADSYEQT--VKKPTSLKTSDRAS-------------------- 251 Aspergillus cla...
KIS68223     357 ----------------------------------DPSLHTRAGR--VEAADSLRSSDRKS-------------------- 380 Ustilago maydis...
O13943       217 ----------------------------------SPSAHSLEKS--LHKPASLQTSDKRS-------------------- 240 Schizosaccharom...
Q08D17       280 qgpnrntenskidtllceheadtngsieklkppsHTSPESVESDweTLDPSILEECISRDeeviwstapehpdllptdti 359 tropical clawed...
Q29HH8       275 tpesataaegeaedlalvssaasagsqcsgdtspHSTPNSQDLN--FASSSSHRESNGRNssltreasvdt--------- 343 Drosophila pseu...
Q17GP2       265 ---kecisgdtdpqgessgsasstaqqmqhsqdtDSGSTSTTREitPCSDDAQLGSLEDAavgrngtnnarpalare--- 338 yellow fever mo...
XP_310874    301 aaleetttssssssspssgssmeaagggdgagpnARAAVALLREtsVDTIASNFSSLYAI-------------------- 360 Anopheles gambi...
CAF98729     285 --naalqgsgrpaaenrssgngaegdnhllkppaRTSPESGDSDweTLDPSVLEEGGTKEaagddqrdaafdpnpetpit 362 spotted green p...
Q5R991       367 slp---itvqpqantgqvvlipglisglEEDQYGMPLAIFTKGYLCLPYMALQQHHLLSDVTVRGFVAGATNILFRQQKH 443 Sumatran orangutan
Q2H333       236 ----------------------------LLSYMGLPLQIFGKGSLFGPYTPLQQLDVLADFGTKSYIVGSTNSLLLQQKD 287 Chaetomium glob...
XP_001268963 252 ----------------------------LLAYMGLPLQIFGKGSMFGPYTPLQQLDLLADYGTKSYVVGSTNSLLLQQKD 303 Aspergillus cla...
KIS68223     381 ----------------------------LLKFLGMPLDIFGPDAFFQPYCPLQQIDLL---KSRSWLVGTSNSIFKQQRD 429 Ustilago maydis...
O13943       241 ----------------------------LLAYTGFPLIIFGEGSMFSPYTPLQLVHVLEAKSSTSWLAGTTNTLIMLNQN 292 Schizosaccharom...
Q08D17       360 ssgsapitvqpqsntgqsvyipglisglEEDQYGMPLAIFTKGYLCLPYMALQQHHLLSDVSVRGFVAGATNILFRQQKH 439 tropical clawed...
Q29HH8       344 -----------------lasnlaalcsvNPDEYRAPVSIFASGNLCLPYLSLPYMDLLSDPMVLSYVIGTSNVLFQQKRQ 406 Drosophila pseu...
Q17GP2       339 ------------tsvdtiasnfsslcaiKPEEWMAPLKIFHEGNLCLPYLSLPYMDLLTDPSVKGYIIGASNVLFQQKRQ 406 yellow fever mo...
XP_310874    361 ----------------------------EPSEWGAPLRIFHEGVLCLPYISLPYMDLLTDPSVKGYMIGASNVLFQHKRQ 412 Anopheles gambi...
CAF98729     363 --------vqpqavsgqgglvqglvsglEEDQYGLPLPIFTKGYLCLPYMALQQHHLLSDVTVRGFVAGATNILFRQQRH 434 spotted green p...
Q5R991       444 L-GDAIVE----------VEEALIQIHDPELRKLLNPTTADLRFADYLVRHVTENRDDVFLDG---TGWEGGDEWIRAQF 509 Sumatran orangutan
Q2H333       288 RySDILIN----------LDEDTINITSPSLKTALQLSTPDRRWIDFITQNVNDTWDDANPSRpktMGYVGSEEFIRVQF 357 Chaetomium glob...
XP_001268963 304 RySDILIN----------LDEDTINISSPSLRNALILSAADRRWIDLLTQIINDTWDEAHPQRpkdHGYMGSEEFIRLQF 373 Aspergillus cla...
KIS68223     430 CkIDVVVD----------LEHAHLEFQDAKLHQMVNLTPEDRKWMDEVISSVVETWNPADPTRptsMGFHGSDDYLRVRF 499 Ustilago maydis...
O13943       293 KmAEVIVR----------SDTHQIEFVDPTIKNLTSLTYTDKSWMEDIISRVESSLEMELP------GFEGSDDWIRNQF 356 Schizosaccharom...
Q08D17       440 L-SDAIVE----------VEEARIQVHDPELRKILNPTTADLRFTDHLVKHVMENRDDVFLDG---TGWEGGDEWIRAQF 505 tropical clawed...
Q29HH8       407 L-ADVLVD----------IEAANLDAHDPELRRQLVLSTEDLRYMDYIMKHVQTPKEDAE----------GSEHWIREQF 465 Drosophila pseu...
Q17GP2       407 L-ADVMID----------VENAVIDVYDMDLKRQTQLSTEDLRFADFIIRNVQNPKEDAE----------GSEVWIREQF 465 yellow fever mo...
XP_310874    413 L-ADVMID----------VESTLIDVLDGETKREMQMSTEDLRFVDFVVRHVQTPKEDAE----------GSEAWIRDQL 471 Anopheles gambi...
CAF98729     435 L-SDAIIDvspeemqksqVDEASIQIQDPELRKVLSLTTADLRFADYLVKHVTENRDDVFLDG---TGWEGGDEWIRSQF 510 spotted green p...
Q5R991       510 AVYIHALLAAT 520 Sumatran orangutan
Q2H333       358 EEYLLSLISSV 368 Chaetomium globosum CBS 148.51
XP_001268963 374 EEYLLALLACM 384 Aspergillus clavatus NRRL 1
KIS68223     500 EDYICAMLSST 510 Ustilago maydis 521
O13943       357 ELYIFGMLATV 367 Schizosaccharomyces pombe 972h-
Q08D17       506 ALYLHSLLSAS 516 tropical clawed frog
Q29HH8       466 QGYILALLRTA 476 Drosophila pseudoobscura
Q17GP2       466 YGYMVALLKSS 476 yellow fever mosquito
XP_310874    472 YGYMVALLKTS 482 Anopheles gambiae str. PEST
CAF98729     511 VVYLHSLLSSa 521 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap