6G2J


Conserved Protein Domain Family
NDUF_B5

?
pfam09781: NDUF_B5 
NADH:ubiquinone oxidoreductase, NDUFB5/SGDH subunit
Members of this family mediate the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone, the reaction that occurs being: NADH + ubiquinone = NAD(+) + ubiquinol.
Statistics
?
PSSM-Id: 401654
View PSSM: pfam09781
Aligned: 19 rows
Threshold Bit Score: 258.825
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6G2J_HH        1 MAAMSLLQRASvsa----ltALSCR--RAGPRLGVGSFL-----------TRSFPKT-V-APVRHsGDHGKRLFVVKPSL 61 
Q7QJ57         1 MAIFSSLARSG---------QFSARlgALLSNPALLQAS-----------KNALTGTrS-----MsGGHGPKNFTITPSR 55  Anopheles gambi...
Q16WV4         1 MAIWSSLARSA---------QVSAQfnSLVRNPVLLTAA-----------KNALVQSrS-----MaGGHGPKMFTITPSR 55  yellow fever mo...
OWR43262       1 MVSWSALGRSF---------GTNLFknNLKSTNLIQNVN-----------FS---LAkT-----LnGDHGHKSMVLQPSR 52  Danaus plexippu...
XP_028029249   1 MVSWSALGRSF---------GINLVknSLKSPNKIQNVT-----------FT---TAkT-----LkGSHGERTMALQPSR 52  wild silkworm
XP_002021090   1 MVGWSRLLSPA---------AQFANyrAVLQAPACRNAL-----------QQ---QLrR-----MgGDHGHHHMTVKPSR 52  Drosophila pers...
1_pfamImport   1 MTVFSSLTRSA---------ATLAFgnGVLRSSATSKIM-----------QNAI-QFrQ-----MgG-HGHKNMFIRPSR 53 
ACH44796       1 MAAMSRVLRAAa--------AWAARraGSAGTTGITGTTgitgitgitgiAPRLPGIl--VPVRHgGDHGKRMFIIKATS 70  zebra finch
Q5ZK61         1 MAAMSLLLRAAa--------AWGAR--RAAGSARLPCLAg----------AARLPGTv--APVRYsSGHGKRMFIIKATS 58  chicken
XP_001368144   1 MAAMSLLLRASasavtraslALTSR--GLGPQLRLGGLL-----------TRGIPGTgAvAPVRHsGGHGKRMFLIKASE 67  gray short-tail...
6G2J_HH       62 YYDARFLRLMKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEHWEYYKHPISRWIARNFYDGPEKNYEKTLAILQ 141
Q7QJ57        56 FQWHKFKDLFHYYIMVGLIPVGAVVFYANVFVGPATLTETPEDYTPKHWEYHRHPITRFIARYILPNPQQEYEKMLHHVY 135 Anopheles gambi...
Q16WV4        56 FQWHKFKDMFHMYVMVGAIPVLAVIFYANVFIGPAQLTETPADYEPKHWEYHKHPITRFIARYMLNNPQQDYEKMLHHLY 135 yellow fever mo...
OWR43262      53 WQWHKFKDMFHYYLMVGLIPVGAIVFYTNVFIGPAELTPIPEDYVPKHWEYHRHPITRFIARYIHNNPQQDYEKFMHYID 132 Danaus plexippu...
XP_028029249  53 WQWHKFKDMLHFYMMVGLIPAGALIFYCNVFIGPAQLTPIPEGYTPKYWEYHRHPITRFIARYIHNNPQQDYEKFMHFLD 132 wild silkworm
XP_002021090  53 FQWDKFKDLMHFYVMLGVVPITALVLYSNIFVGPAQLAEIPEGYVPKHWEYEKHPISRFISRYIFSSQQQEYEKALHNLF 132 Drosophila pers...
1_pfamImport  54 FQWDKFKDMLHYYVMIGLIPITAIVMYCNIFVGPAELAEIPKDYEPKHWEYHSHPITRFLARYMYPSPQQEYEKMCHAMF 133
ACH44796      71 FYDSRFLSLLRFYLFVTGIPVAVLLTYINIFVGEAELAEIPEGYVPEHWEYYKHPITRWIARYVLDPPEKNYEKDMALLD 150 zebra finch
Q5ZK61        59 FYDTRFLNMLRFYIFLTGIPVVLFITYVNIFIGEAELAEIPEGYIPEHWEYYKHPISRWIARYLLDPPEKNYEKEMAFIN 138 chicken
XP_001368144  68 FYDKRFLKLLRFYLLLTGIPVAVGITFVNIFIGEAELAEIPDGYVPEHWEYYKHPITRWIARYVYEPPEKNYERTMAILQ 147 gray short-tail...
6G2J_HH      142 IESEKAELRLKEQEVRRLMRARGDGPWYQFPTPEKEFIDHSPKATPD 188
Q7QJ57       136 EENEKAQIRALEKEVRAKMAERNDYQSYYYRPAIGKYHRVAKEAAEQ 182 Anopheles gambiae str. PEST
Q16WV4       136 EENEKSQMLALEAKIRQKMAERHDYQSYYYRPAIGKYHRVAKEAADH 182 yellow fever mosquito
OWR43262     133 EEAQKVKLRALEKMVTQKMAERNDYQAYYYRPMVNKYLRVNKQVGDE 179 Danaus plexippus plexippus
XP_028029249 133 EEQQRIKLRALEKEIIKKMAERQDYQAYYYKPMVNKYLRMNKRTGDE 179 wild silkworm
XP_002021090 133 EENEKAQIRKLEKEVRRKMSERNDYQSYYYRPTVAKYHRISKEAADE 179 Drosophila persimilis
1_pfamImport 134 EENEKAQLRKLEKEIMAKMADRQDYQAYYYRPAITKYHKVSKEAADY 180
ACH44796     151 VEMRKSELRLLELEARRLMRHRGDGPWYHYETPDKNLVDNSMKATPD 197 zebra finch
Q5ZK61       139 VEAQKAEMRLMELEARRLMRQRGDGPWYQYETPDKNLVDNSMKATPD 185 chicken
XP_001368144 148 VEAEKADLRLKLQATDRLMRERGDGPWFHYPTVDKALIDHDTKAAPD 194 gray short-tailed opossum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap