Conserved Protein Domain Family
OSTMP1

?
pfam09777: OSTMP1 
Osteopetrosis-associated transmembrane protein 1 precursor
Members of this family of proteins are required for osteoclast and melanocyte maturation and function. Mutations give rise to autosomal recessive osteopetrosis; also called autosomal recessive Albers-Schonberg disease.
Statistics
?
PSSM-Id: 401651
View PSSM: pfam09777
Aligned: 15 rows
Threshold Bit Score: 249.955
Threshold Setting Gi: 189236935
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAP22358      37 CQKYVEKFAYYQAEMVACATNWSIPPKVCTNCYQNYINFKTYEFE---TKNlNNVFslDNrtCSQVIYDNYLLSYSSDIS 113 Caenorhabditis ...
Q09322        42 CQKYVEKLAVVQSEMVACATNWSIPPVVCTKCFQNYINFKQFEYE---TKNlNNVYslDNrtCSQVIYDNYLLSYSTDIS 118 Caenorhabditis ...
NP_001280434  40 CQNLLQSFANETARFTLCVVTNARPITVCEKCVNEFNQVFKRYEE---IQKlHNND--SEvdCRAVLTNIDRLQVVYASY 114 pea aphid
XP_001807287  25 CTELKEQFASATAEFSSCAIQNSRPVTFCENCVNAYIQIVDSYNG---MKEvPD----NGtyCIDRFVNLDRLGIVQTSY 97  red flour beetle
Q0IHW1        27 CLRLLAEFANHSASLSSCLVYNARPVRLCQHCYTEYVQLQTTMQSi--EAPlQNGT--VS--CAASLLQSDRVQVIVILN 100 tropical clawed...
Q4QQU9        88 CRELLMDFANSSAELTACMVRSARPVRLCQTCYPLFQQVAIKMDNi--SRNvGNAS--ESqrCAGSLLMADRMQIVVMVS 163 Norway rat
XP_001511508  78 CRALLVLFARSSARLTDCLGRGARPVRVCQTCYPLFREVVGSMENisrAAGpGNAS--EShnCARSLLMSDRMQIVVILS 155 platypus
XP_008119023  52 CRELLAGFANSSVRISGCLVRHARSVTVCQNCYRPFREVTEQLENi--SRAaGNTT--ESnpCAKSLLMSDRLQIVLIMS 127 green anole
Q5ZMW4        57 CRRLLTAFAEGSATLSGCLARRARPVRLCQACGGLYRSLLTQYGDi--ARAvGNSS--EShnCAKSILTSDRLQVVVTLS 132 chicken
XP_003449914  76 CSDLLHIFGQRYVAYVNCLVPAARPVKVCQSCYSTYGNLVEIYNNi-sSDQmGPGN--VT--CRDSLLRSDRLMLVYQLY 150 Nile tilapia
CAP22358     114 TALTsKIWEKSRCDSCVtitwslhdNKSAPTFTDRTIQFQQRLYEWRNCVVNYTSgdvldpkmvpndpiltpedlkNSSK 193 Caenorhabditis ...
Q09322       119 KALTsEIWEKSRCDSCItikwnfpqNKSEVSFSERTMQFQNRMYEWRNCVVNYTSggvld------------dnltNGSK 186 Caenorhabditis ...
NP_001280434 115 NYVL-DMWEKASCKLCL----------NGTVFNDKTRGVMIRGDNLDKCISKHINnt-----------------klSNTS 166 pea aphid
XP_001807287  98 INSY-NLWNNAKCYECFqv----vdGKLTPNKSLETIAFNKYYDNFMQCINGtd---------------------iNDTT 151 red flour beetle
Q0IHW1       101 DFFE-QTWEESKCSQCL--------QNQSQSLLNTTSEFMEMFLSLGTCF--NLSrkeptv----------vsqqgNFSS 159 tropical clawed...
Q4QQU9       164 EFFN-STWKEANCANCL--------TKNSEDLSNNTQDFLSLFNKTLACFEHNLQgrtys-----------lpppkNYSE 223 Norway rat
XP_001511508 156 EFFN-TTWQEANCANCL--------MNNSEGLSNSTIHFLDLFNITMTCFEQNLQggess------------lqlrNYTD 214 platypus
XP_008119023 128 NFFN-ATWKKANCANCL--------KNNSEGLSNSTVTFLALFNESMACFEHNLQrqeds------------rllgNISD 186 green anole
Q5ZMW4       133 SFFN-DTWEAANCANCI--------KNNSEGLSNSTQEFMDLFNKSLACFEHNLQgqamd------------lspnNYTE 191 chicken
XP_003449914 151 SNLE-SLWEDSNCAKCV--------TEHLESLTNDTLYFMATLNQTLTCFEKYQQg--------------------NHTE 201 Nile tilapia
CAP22358     194 ICNECKSEFDELYKFYWKIYTt--------pDVDFCVDVETTMNDTIHL-DDVWQCAERQdrNRDLFGIMVTFAtLMLLT 264 Caenorhabditis ...
Q09322       187 ICNLCKTTFDELFGYYWKIYTt--------pDVDFCVDVETTMNDTIHLwDDVWKCAEKQdrNRDLFGIMITFGtLLLLT 258 Caenorhabditis ...
NP_001280434 167 LCADCKQYYVNLTNYYNKHKN----------DNTFCMDVVDLINNTQSDwSLKWKCHESN--YESEWVLLVISFiVLLLP 234 pea aphid
XP_001807287 152 LCPTCIDDYLDLNSYYHSISNen-------eKIGGCMDMVDLINNTRQFwSQ--KCCKYR--RHDEHIFLASAItVLIVT 220 red flour beetle
Q0IHW1       160 ICRNCSKNYRELNDLYSKLEK----------EKALCIDLEDAMNSTRILwSKTFNCTVPC--TDTVPVIAVSAF-ILFLP 226 tropical clawed...
Q4QQU9       224 VCKNCKEAYRTLSLLYSEMQKmngleskaepGTHLCIDVEDAMNITRKLwSRTFNCSVTC--SDTVSVVAVSVF-ILFLP 300 Norway rat
XP_001511508 215 VCKNCRESYKSLSALYAEMQKrndhenkaehGTHLCIDVEDAMNVTRKLwSRTFNCSVPC--SDTVPVIAVSVF-VLFLP 291 platypus
XP_008119023 187 VCKNCNVTYKKLNDMYNSMQKsgked-eseeEFHLCIDVEDAMNITRRLwSTSFNCSVHY--SDTVPMIAVSSF-ILFLP 262 green anole
Q5ZMW4       192 VCKNCNGTYKKLNDLYNKLQRlnrhgdesghSAHLCIDVEDAMNITRKLwSRTFNCSVPC--SDTVPVIAVSSF-ILFLP 268 chicken
XP_003449914 202 LCKNCKSAYGTLNVLYSQMEK----------NSTLCIDIEDAMNMTRRLwSKNFNCSFPR--EENVPVIAVSSF-MLFLP 268 Nile tilapia
CAP22358     265 ALFYAASYIQGGGQQRNLVRYSRLSDPRGQRS 296 Caenorhabditis briggsae
Q09322       259 ALFYAASYIQGGGETRRLIQYARLSDPHGQRS 290 Caenorhabditis elegans
NP_001280434 235 ILFYFINWLISQKRSNVLLSQNRWHqrftsna 266 pea aphid
XP_001807287 221 LLFYVIAQFSSVKKTPTIMQQTRFAESLSHns 252 red flour beetle
Q0IHW1       227 IIFYLSSYLHSEQKKRKLIFPNRIKSNASAVN 258 tropical clawed frog
Q4QQU9       301 VVFYLSSFLHSEQKKRKLILPKRLKSSTSFAN 332 Norway rat
XP_001511508 292 VVFYLSSFLHSEQKKRKLILPKRIKSSTSFAN 323 platypus
XP_008119023 263 VVFYLSSFLHSKQKKRILMPSKRFQSNDSSVN 294 green anole
Q5ZMW4       269 VVFYLSSFLHSKQKKRILILPKRIQSNASLVN 300 chicken
XP_003449914 269 IIFYLSSFLHSEQKKRKLIHPRRAKSNTSLMN 300 Nile tilapia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap