Conserved Protein Domain Family
PAT1

?
pfam09770: PAT1 
Topoisomerase II-associated protein PAT1
Members of this family are necessary for accurate chromosome transmission during cell division.
Statistics
?
PSSM-Id: 401645
View PSSM: pfam09770
Aligned: 36 rows
Threshold Bit Score: 835.071
Threshold Setting Gi: 528318296
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EPE07006       1 MAFFGFDPSR------HNTAAPGFSQANDPFAGLSGGNPV-------DNALEFEDTYDGLGDQLVETGDAFNDDTFgdas 67  Ophiostoma pice...
XP_007776195   1 MSFFGFDATLprd-rgHQAYKPGFGATPDAFAGLSGRDDDa-------DALDFEDTYDGLGDRLDETDDAFNDDTFgg-- 70  Coniosporium ap...
EKG16745       1 MSFFGFDTSLprdrpaHQQNAPGFGQTPDPWAGLSSQGARg-----dDDALDFEDTYDGLGDQLDETDDAFNEDTFgg-- 73  Macrophomina ph...
EOD48208       1 MSFFGFDTSLprdrpaHQPSAPGFGQTPDPWASLSSQGARgd----dDDALNFDDTYDGLGDQLDETDDAFNDDTFgg-- 74  Neofusicoccum p...
O42958         1 MSFFGFNTTLpkenmfpn------------------------egqleedgIDFEETYDDLGNQLNEAGDELNDETFg--- 53  Schizosaccharom...
XP_009153690   1 MSFFGFDTALprd-kpNNDNNKGIFEHTNPFNEVAKARKLqafqndqEDVIDFDDTYDGLGDQLEEAGDDFNEDTFgg-- 77  Exophiala derma...
EGC47536       1 MSFFGFDTTLprd-rpSGQQTRGIFENPDPFAHVAHAVVQd-----dEEAIDFEDTYDGLGDQLDEDQDAFNDDTFgg-- 72  Histoplasma cap...
XP_002541197   1 MSFFGFDTTLpnd-rlPPQESRGIFETPDPFAEVARATAHgfh--gdDDAIDFEDTYDGLGDRLDETQDAFNDDTFga-- 75  Uncinocarpus re...
CAP95933       1 MAFFGFDTTLpr--drDGTGAKGFFENPDPFADIARANALg-----dDDVIDFEDTYDGLGDQLSDDQDEFNDDTFgg-- 71  Penicillium rub...
GAD98161       1 MSFFGFDTTLprd-raAAGERRGIFENPDPFAEVVRAKAGghd--ddDDAIDFEDTYDGLGDQLDEGQDEFNEDTFga-- 75  Byssochlamys sp...
EPE07006      68 gaggvgggIGGsaFGPSKVGKDFDYFKQTAQVADAIDQEHMRFNLLQPATrgapirhdynqgppassQHYGFFAPEPVAS 147 Ophiostoma pice...
XP_007776195  71 --------eP---ATQQNVAKDFDFSGQTAKIANTLQEEQMLYTARQPPP-----------------KASPPKR-----A 117 Coniosporium ap...
EKG16745      74 --------pS---A--NNVGKDFDFSGQTSKIAGTIQEEQMLYSARQPPP-----------------REKKEERr----- 118 Macrophomina ph...
EOD48208      75 --------eP---V--QNVGKDFDFSGQTAKIAGTISEEQMLYSARQPPP-----------------RERRDERk----- 119 Neofusicoccum p...
O42958        54 -------------VSAGSIGRDFDFSGTTAQASAQLEDEQyqinqqnifa-------kpvkpasselPQVSRLNGASQFP 113 Schizosaccharom...
XP_009153690  78 -------gAEG--VSNQGVGKDFDFFGNTAQVSNAIEEEAMRFNLRHPSR-----------------------ETTSTQP 125 Exophiala derma...
EGC47536      73 -------gA----DE-KSVGKDFDFYGKTAQMSNVLDEEQMLYKLKHPPR-------------------ESKPKSPTRTP 121 Histoplasma cap...
XP_002541197  76 -------aAG---DEGKPVGKDFDFFGQTAQMTNVLGEEQVIYNLKHQKD-------------------TPKASAPLHEP 126 Uncinocarpus re...
CAP95933      72 -------tGA---D--TSVGRDFDFFGKTAQVSDAIGEEQVRFSLQNPNAtrv-------------apqPAQVPVQPAAT 126 Penicillium rub...
GAD98161      76 ----------------dDVGKDFDFFGKTAQVSDVLSEEQFRYSLQHHEPssa-------------pqhPAPASTSTSTV 126 Byssochlamys sp...
EPE07006     148 R--PVRTGYEKYN--EPEAELTVDAALWG--VAPKKPAASTAAaapm---------satPVQAAIAgps----------- 201 Ophiostoma pice...
XP_007776195 118 Ak-PARTGYENYAqpDYIPKLEANAGLWG--IPPKKASPQPQAhq-------------rQESQGAPiaa----------- 170 Coniosporium ap...
EKG16745     119 ---PVKTGYENYAqpGYIGNLEASADIWG--I-PKKSTPS-HEnq-------------rHQLPAQQiapp---------- 168 Macrophomina ph...
EOD48208     120 ---PVKTGYENYAqpGYIGNLEASADIWG--I-PKKSTPS-QEnq-------------rQQVSMQQmqqmqqmqqqqqsh 179 Neofusicoccum p...
O42958       114 SrePASTAINK------LSDLQPMASIWEniVPEKPAIIP-------------------PEVASLQdrlg---------- 158 Schizosaccharom...
XP_009153690 126 Pk-PKKTGYEKYQdpGYIPEIQAKSGAW---KKAQTSTPPNQAqaeeprvstarfnapaPAISHTPeas----------- 190 Exophiala derma...
EGC47536     122 Ak-PTRTGYELYQdpGYIPEIQAKSAVWG--TGVGQK-----Ska-------------eDDTQPLKpaa----------- 169 Histoplasma cap...
XP_002541197 127 Sk-PKRTGYEPYQdpGYIPEIQAKSSVWG--TGITQK-----Skp-------------vEQAQAVva------------- 172 Uncinocarpus re...
CAP95933     127 Qt-TKRSGYEKYSdpDYIPDLQAKSSVWG--VSQKK------Pep-----------------aAAApa------------ 168 Penicillium rub...
GAD98161     127 Qk-PKKTGYEKYQdpGYIPEITAKSSVWG--TTATQRSYVEPPkp-------------aPQPQPQPvpa----------- 179 Byssochlamys sp...
EPE07006     202 ----asRKILSLEEVEAAM--RAKKTPASQQQP---------------QVPHgyPQQ---------IP------------ 239 Ophiostoma pice...
XP_007776195 171 ---essRKMMSLEEVEAAM--RAQSRKPAAPQPqvpqap----qlfapVPPA--QPSpaefshqagFGvppqi-----lq 234 Coniosporium ap...
EKG16745     169 ---aagRKMMSLEEVEAAM--LAESKNRAVQQPvqppvtqstpqpsmpGFPQ--QPApnwp--qqpFGapphilq-rpqq 238 Macrophomina ph...
EOD48208     180 hqasasRKMMSLEEVEAAM--LAQSKQRAPQHPgqppatqptpqpampGFPQ--QPPpnwg--qqpFGappqilq-rpqq 252 Neofusicoccum p...
O42958       159 --aqpsEKVFSLQELEEQLlnSMTAPKPPSQPAipiv------------------------------------------- 193 Schizosaccharom...
XP_009153690 191 ----qaPRIMTLEEVEAAL--LAQAQAQAAQAAqaaq-------apppGFPQ--------------PQqpy--------- 234 Exophiala derma...
EGC47536     170 ----paKKIMSLEEVEAQM--RAQSKKLQATEQlsappp---plptipQFPV--AAAqva---aplTMplhdrpapppdg 235 Histoplasma cap...
XP_002541197 173 ----paRKMMSLEEVEAQM--RAQTQRPQPKAEppas-------lpsqQFPI--NASqpm----plNLraqeapiphpdn 233 Uncinocarpus re...
CAP95933     169 ----psRKMMSLEEVEAQM--RFHGHNTATPAAeafm-------rsmvEQPQ--YQPqlq----hlQTlpdg-------- 221 Penicillium rub...
GAD98161     180 ----asRKMMSLEEVEAQM--RAQS------QRatap-------qpavSIP---PVAelp---pmpQHgqpmppm-plda 233 Byssochlamys sp...
EPE07006     240 ---EQYQQPPLDYSYGMPPPEMMGVPPQFQNLAP-QMSILQRPTSQQTPPGFPPIPSHLQqqqqqqqqqp----qpnqea 311 Ophiostoma pice...
XP_007776195 235 rpqAAYDQRPLSAPRPPAQAELPPQGVq-------HPQILQRQ------------RPVQPepvahrqapqq--paaqpqr 293 Coniosporium ap...
EKG16745     239 fppQFSQQRPPSIPQQQMPHELPGQSVp-------SPQLLHRQ------------RQEQQglrgtppqp-------pmhq 292 Macrophomina ph...
EOD48208     253 fnqQFLQQRPPSIPQQQMPHELPAQSIq-------QPQILQRQ------------RQEQQgprgt--------------- 298 Neofusicoccum p...
O42958       194 --------------------------------pseMAAQVTRENISSLDPAISAASIGNVtfgqpnipstttdfaglaap 241 Schizosaccharom...
XP_009153690 235 -pfPMQQMQPPPQQYQQMPPPMPTGQQQPPQQRIpSPQRHNRMPSQPAQAPQPRPPQQpqqpq----------------- 296 Exophiala derma...
EGC47536     236 mlpLSLQEFPPLD-Q-------GQYAQL--GKDArAAQAFQRQQPF---PPMETMLPRpgm------------------- 283 Histoplasma cap...
XP_002541197 234 fahFQQKDFPPLSQH-------QQYPQF--GGYGpLPQDLQRQQL----RPL-QERSRqna------------------- 280 Uncinocarpus re...
CAP95933     222 fppVP----PEFI-----------QAQM--KQGHlPPQ-IPHPPPG---MPELYGGPKhmp------------------- 261 Penicillium rub...
GAD98161     234 yaqMI----PESVRF-------EQQAQF--ARGMsPMQPFQGQPQP---VPEPFPGSAvpp------------------- 278 Byssochlamys sp...
EPE07006     312 asnrPTQILQNPNRQpaagemaqfggitlpfpgqqpPAH--QRQDSsFGG------------------APHIITH-PSQV 370 Ophiostoma pice...
XP_007776195 294 ppsqPRQILQNPNrlsgqgq----------piaqpgPRHgmQQMGP--GHqrg------------psyPANVVTY-PQQI 348 Coniosporium ap...
EKG16745     293 ppqqPRQILQNPNrlsgpgq----------pvtqpfNRv--PPTGP--THgrg------------psyQSPVITH-PEQL 345 Macrophomina ph...
EOD48208     299 ppqqPRHILQNPNrlsgqgq----------pisqpfNRm--PPTGP--AHarg------------psyQGQVITH-PEQL 351 Neofusicoccum p...
O42958       242 nmvhPSQAIPNPVMQpslvpqmpyp-qngmynpsvaP---------------------------------------PASL 281 Schizosaccharom...
XP_009153690 297 qpqqPLHILQNPSRPrhspqpsvd---raqgasqygPPQt---------------------------gPLPIITH-PQQL 345 Exophiala derma...
EGC47536     284 -pptPNH--HQNRLPpnpapq--------------------ypmrqaQHHhpkpqa------smgppgPLPATSGmPPNM 334 Histoplasma cap...
XP_002541197 281 -piqVLQ--HQNRAMnipqrp---------------------tgpqvQGHfpqtqp------ppntagQLPSIAAmHPQF 330 Uncinocarpus re...
CAP95933     262 -pggPLHMMQNANLPpqnmppp--------gprhagPPQaqRPQ---QPQppqplphqqgplgrvsnnGMPVITN-PQQL 328 Penicillium rub...
GAD98161     279 --paPLQLLQN-QVRpqqvppqa------pqqrhggHPRvsR-----QPQqpvm----------gpngPLPIITT-PQQL 333 Byssochlamys sp...
EPE07006     371 QGLTEEE---KVVYMEQEAKRAKRNHKIFLLSKNNGLMTPQDKNFVTRIQLQQLVSATGNPNDHGTDEALKEDFYYQVLS 447 Ophiostoma pice...
XP_007776195 349 LDMSSEE---RAAHLEAEAKRAKRNYKIHLLSKDNGLMTPQDKNFITRIQLQQLVTATGGVDDQGPEAALAEDFYYQVYS 425 Coniosporium ap...
EKG16745     346 LRLSDAE---RAAFLEEDAKRAKRIHKIHMLSKDNGLMTPQDKNFITRIQLQQLVTATGSVDDQGPEAALAEDFYYQVFS 422 Macrophomina ph...
EOD48208     352 LRLTDAE---RAAFLEEDAKRAKRIHKIHMLSKDNGLMTPQDKNFITRIQLQQLVTATGSVDDQGPEAALAEDFYYQVFS 428 Neofusicoccum p...
O42958       282 VNLFQQEqliQNQNLDEKRQKLERDH--MLMAQCAGLMTRSDKSFIARIQISQLMS----------EDPESDDFYYRVYS 349 Schizosaccharom...
XP_009153690 346 MELSEEQ---RRAYLEEDAKRAKRNHKIFLLSKGNGLMTPQDKNFITRIQLQQLVTATGASADGNSEAALGEDFYYQVYS 422 Exophiala derma...
EGC47536     335 VPMTEEQ---RKANLIEDAKRAKRNHKIFLLSKGNGLMTPQDKNFITRIQLQQLVAATGNVTDPESEASLSEDFYYQVYS 411 Histoplasma cap...
XP_002541197 331 MQLPEEQ---RKALLAEDAKRAKRNHKIHLLSKGNGLMTPQDKNFITRIQLQQLVSATGNTGETDHDSLLSEDFYYQVYS 407 Uncinocarpus re...
CAP95933     329 MHLTEEQ---RQAYLVEDAKRAKRNHKIFLLSRGNGLMTPQDKNFITRIQLQQLVAAAGNVADSDPEAVLAEDFYYQVYS 405 Penicillium rub...
GAD98161     334 MNLPEDQ---RMAYLVEDAKRAKRNHKIFLLSKGNGLMTPQDKNFITRIQLQQLVAATGNVADPDPEAVLSEDFYYQVYS 410 Byssochlamys sp...
EPE07006     448 QIRGSSRQHPNQPLNNFAQTYLFQTGSRMHSRRymNRDRGAETHVQRMEQQVQRAVEAAKNRPKNKQLVIEGTLGKISFS 527 Ophiostoma pice...
XP_007776195 426 QIRGAPRQNPNQPASQFAQTYLFQTGGRYGNNR--RRPRGGDNHIQRMEQQVQRAVEAAKAKPKNKQLVIEGSLGKISFS 503 Coniosporium ap...
EKG16745     423 QIRGAPRQNPHQPASQFAQTYLFQTGGRYGG-R--RHNRGGDNHAQRMEQQVQRAVEAAKAKPKNKQLVIEGSLGKISFS 499 Macrophomina ph...
EOD48208     429 QIRGAPRQNPHQPANQFAQTYLFQTGGRYGG-R--RNNRGGDNHAQRMEQQVQRAVEAAKAKPKNKQLVIEGSLGKISFS 505 Neofusicoccum p...
O42958       350 IIRG--RKPSEEEASHFIQTYLGPSNNR-------RRGRRSENPMQKLQQQLQRLVSSAKERPKATQLSLEGALGKIAVN 420 Schizosaccharom...
XP_009153690 423 QIRGAPRQHPTQPLGHFAQTYLYQTGSRGGGr---RQHVNGDNHMQRMQQQVQRAVEAAKLKPKNKQLIIEGSLGKISFS 499 Exophiala derma...
EGC47536     412 QIRGAPRQHPRQPLGYFAQTYLFQTGGRSAGGMgrRQFYTGDNHMQRMQQQVQRAVEAAKLRPKNKQLIIEGSLGKISFS 491 Histoplasma cap...
XP_002541197 408 QIRGAPRQHPRQPLGHFAQTYLFQTGNRSGNNSgrRQYQNADNHMQRMQQQVQRAVEAAKLRPKNKQLIIEGSLGKISFS 487 Uncinocarpus re...
CAP95933     406 QIRGAPRQHPHQPLGHFAQTYLLQTGNRLGGHRr-GNFQSADNHMQRMQQQVQRAVEAAKAKPKNKQLIIEGSLGKISFS 484 Penicillium rub...
GAD98161     411 QIRGAPRQHPRQPLGHFAQTYLFQTGSRTGGHGr-RHYQNADNHMQRMQQQVQRAVEAAKLKPKNKQLIIEGSLGKISFS 489 Byssochlamys sp...
EPE07006     528 NAKTPKPLLNIKRS---ENPASPaspsaaaaaaAASAygtasss-taaktlDRKTVLSSIEKVYATLMEIEDQDRKMPPP 603 Ophiostoma pice...
XP_007776195 504 NAKTPKPLLNIKRT---ESGTPR----------PESAarrpshmhrdpttaDRKVVLKDIENVYSTLMQMEDHERHMPPP 570 Coniosporium ap...
EKG16745     500 NAKTPKPLLNIKKP---EGESK-----------PNGPgrrpsr--ghnevaDRKATLRNIENVYNILMKMEDHERNMPPP 563 Macrophomina ph...
EOD48208     506 NAKTPKPLLNIKKP---EGEGK-----------PNGAkhhpra---hhdvaDRKATLRNIESVYNVLMRMEDHERNMPPP 568 Neofusicoccum p...
O42958       421 TVRTPRQLLNVKRPtepASSNSSlnnf--------------------sgfsTKKDVLHAIEKVYDLLLDFEQALRKAST- 479 Schizosaccharom...
XP_009153690 500 NAKTPKPLLNIKRQ---ESHDAR----------PSTGkkev-------sssDRKTILRNIEAVYTTLMRLEDHERQMPPP 559 Exophiala derma...
EGC47536     492 NAKTPKPLLNIKRP---DSSDGQ----------KTSNvkkghh--talsasDRKSILNNIENVYGTLMQMEDHERNMPPP 556 Histoplasma cap...
XP_002541197 488 NAKTPRTLLNIKRP---DSADGH----------KPTNvrkaah--tglspsDRKSILHNIESTYDTLMKMDDHERRMPPT 552 Uncinocarpus re...
CAP95933     485 NAKAPKPMLNIKRP---DSSEGP------------KPkkqsd-----lslsDRKSILTNLEGVYSALMAMEDMERTMPPP 544 Penicillium rub...
GAD98161     490 NAKTPKPLLNIKRP---ESSEGV------------KPtkkath--telspsDRKSILNNIESVYATLMKMEDMERNMPPP 552 Byssochlamys sp...
EPE07006     604 ATSSEDLELIQRHVEWADNSKHLAAKLWRYLKVHEQI--GAYTVHPFIALLSFPKGMQAIPRVFRNL-SREQRTTVLTMI 680 Ophiostoma pice...
XP_007776195 571 LAEDSEPAVVEAHMLWRQTIQSLNEKLWRELKVMEPIipNSPTPHPFIAILSHPKGKKAVPRIFRHI-TDQQRITILTMI 649 Coniosporium ap...
EKG16745     564 LNDGSSPEQIQEHMEWRHTYQGLNQKLWQGLKVLEPInpGSNIPHPFIAILSHPKGKKAIPRIFRQLhEEQQRVTILTMI 643 Macrophomina ph...
EOD48208     569 LNDGSSPAQIQEHMEWQHRAQELNQNLWQGLKVMEPImpGSNVPHPFIAILSHPKGKKAIPRIFRHL-DEQQRVTILTMI 647 Neofusicoccum p...
O42958       480 ----LETTDQEQIDTWKTTLSEKLESIWKALYINESLeaSSKTRPPFISIISHPKGMRLLPRLFPHL-SKEQQISILKVV 554 Schizosaccharom...
XP_009153690 560 PTE-GDADSIQAHLDWRQKMQELNSKLWQELKVLDPIvpGSSVPHPFIAFLSFAKGKKAMPRIFRLI-DQEQRLTILTMI 637 Exophiala derma...
EGC47536     557 PDE-SDLESVERHMEWRQKMQSLNQKLWADMKILEPIvpGSSTPHPFIAFLSYPKGKKAIPRIFRQI-DQEQRVTILTMI 634 Histoplasma cap...
XP_002541197 553 PDA-EDAEAVEKHLEWRQKREALNQKLWTDMKVHEPIfpGSPTTHPFIAFLSYPKGKKAIPRIFRHI-DQEQRVTILTMI 630 Uncinocarpus re...
CAP95933     545 PEE-GDAEAIQEHMEWRQKLHSLNQKLWRSLKVMEPIvpNSTTPHPFIAFLSYPKGKKAIPRIFRHI-DQEQRVTILTMI 622 Penicillium rub...
GAD98161     553 PDE-SDPEAITRHMEWRSKIQALNQKLWQELKVMEPIvpGAVTPHPFIAFLSYSKGKKAIPRIFRHI-DQEQRVTILTMI 630 Byssochlamys sp...
EPE07006     681 IVHLDQLDIVRNAQA-----NSGLP-VTAAMRENIDRFSMTVNSTLFTFMNELDLDLVTGVLGLI-TSCKVDVIAKSRIG 753 Ophiostoma pice...
XP_007776195 650 VVHLDALDVIRNAVPthlngID--QpIPASVREDVELFAQTVLPPFFAYLAEAPLNIATGLLGLVlDRTNLTAVARTKIG 727 Coniosporium ap...
EKG16745     644 VVHLDMLDVVQHGIP-----VDPLTpLPRAAKEEIELFAHAVLPPLFAYVNEAPLNIVIGLLGLVlDRTNIPVLVRTKIG 718 Macrophomina ph...
EOD48208     648 VVHLDTLDVVQNGIP-----ADPLTpLPRAAKDEIELFAHAVMPPLFAYVNEAPLNIVIGLLGLVlDRTNIPVLVRTKIG 722 Neofusicoccum p...
O42958       555 VYNFDSLDIVLRGTFd----VNGE--LPLDVVSEMSSFTQFIIPPLLTIVNELDLETINNLFSQLlNRTNAVYLIQTKIG 628 Schizosaccharom...
XP_009153690 638 VVHLDQLDVTKDARP-----APGESqPPAAIREEIELFSQAVMPCLLQYVNEAPINIVIGLLGLLiDHTNIATVAMTKIG 712 Exophiala derma...
EGC47536     635 IVHLDSLDVVQRAQL-----QSGESqPPLPVREEVDLFSHAVMPSLLGYVNEAPINIITGLLGLViGQTHVQTVAKTRVG 709 Histoplasma cap...
XP_002541197 631 IVHLDTLDVIQRAQL-----QPGEIqPPGPVREEIDLFSQAVMPSLLSYVNEAPLKIIIGLLGLLvFRTNVHAVSKTRIG 705 Uncinocarpus re...
CAP95933     623 VVHLDSLDVVRLAQP-----VPGEAqPSLGVREAIDLFSLAVMPCLLGYVNEAPFNIIIGLLGLViNQTHVQSVARTKVG 697 Penicillium rub...
GAD98161     631 VVHLDSLDVVRWAQP-----RLGEVqPPAAMREEIELFSQAVMPSLLGYVSEAPFNIIIGLLGLVlAQTQVPIVARTKVG 705 Byssochlamys sp...
EPE07006     754 ASVMTMVLSRAEEIKQANGGT---PEHRLSWENAYNEFFNKIEPTLPYMFPGT--VFVDEDIYVWQFLAAMGICATPDQH 828 Ophiostoma pice...
XP_007776195 728 LLVLTMFVSRAELLRPVPPAPpsaQDDWVQWTELYTRLFDAVEPVLPFVFPGS--VNDAEDVYVWQFLAAMGVGASPEQQ 805 Coniosporium ap...
EKG16745     719 LSILTIFISRAELVKESTPPSaasAQDLQQIEQLYNRLFDAVEPVLPYIFPGT--VKDDEDVYVWQFLASMGASASAEQQ 796 Macrophomina ph...
EOD48208     723 LSILTIFVSRAELVKESTPSSaatTQDLQQIEQLYNRLFDAVEPVLPYIFPGT--VKDDEDIYVWQFLASMGASASAEQQ 800 Neofusicoccum p...
O42958       629 LSFLTLFISRAEILKQSGTVN---QNEKEEWENTFNVMFNRVKGHFSTVFPppnaraYADESYPWEFLAACATAASSEQH 705 Schizosaccharom...
XP_009153690 713 LGMMTMLLTRAELLKESGVVS---DQEWQQWTALYNRLFDMLEPLLGSLFPGP--VNSGDDMYIWQFLATIGIGASPDQQ 787 Exophiala derma...
EGC47536     710 LGVLTMLLSRAELVKEAGGVE---DEQWKPWTELYNTLFDRLEPVFGDIFPGT--INSGDDMYVWQFLAAVGIGASPEQQ 784 Histoplasma cap...
XP_002541197 706 LGILTMLLSRGELVKETGAVE---DEELKQWMDLYNKFFDRLEPILGSIFPGS--INSGDDIYVWQFLAAVGIGASPEQQ 780 Uncinocarpus re...
CAP95933     698 LGILTMLLSRAEIVKEAGQAS---EHDWQQWVEKFNVLFDTLELGLNDIFPGS--ISSGDDMYVWQFLAAVGIGASPEQQ 772 Penicillium rub...
GAD98161     706 LGILTMLLSRAEIVKEAGQAD---ERDWQQWTEKFDVLFDTLEPILADVFPGS--INTGDDMYVWQFLAAVGIGANPEQQ 780 Byssochlamys sp...
EPE07006     829 SRLVISVKDRVMDTVAAAKTLPVDLATQRKQSVNLFMRSIGLDVE 873 Ophiostoma piceae UAMH 11346
XP_007776195 806 QRLVLGVKERVMETVAACRALPEEMRARRLGDVNLFMRAIGLDVE 850 Coniosporium apollinis CBS 100218
EKG16745     797 QRLVIGVKDRVMDTVNICKALPKELSAARLGHVNLFMRAIGLDVE 841 Macrophomina phaseolina MS6
EOD48208     801 QRLVIGVKDRVMDTVNMCKALPKELSATRLGHVNLFMRAIGLDVE 845 Neofusicoccum parvum UCRNP2
O42958       706 FTLVSETRDRVLDNIITSKRAPSEIAVVRISNVNLFLNAMGLDAR 750 Schizosaccharomyces pombe 972h-
XP_009153690 788 QRLVIGVKDRVMETVQQSKTLPPDMASVRLGNVNLFMRAIGLDVE 832 Exophiala dermatitidis NIH/UT8656
EGC47536     785 QRLVIAVKDRVMETVAQSKTLPADMASQRLGNVNLFMRAIGLDVE 829 Histoplasma capsulatum H88
XP_002541197 781 QRLVIAVKDRVMETVSQSKTLPADMASQRLGNVNLFMRAIGLDVE 825 Uncinocarpus reesii 1704
CAP95933     773 QRLVIAVKDRVMETVGYSKTLPADMGSQRLNNVNLFMRAIGLDVE 817 Penicillium rubens Wisconsin 54-1255
GAD98161     781 QRLVIAVKDRVMETVAQSKTLPADMASQRLGNVNLFMRAIGLDVE 825 Byssochlamys spectabilis No. 5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap