Conserved Protein Domain Family
FPL

?
pfam09758: FPL 
Uncharacterized conserved protein
This entry represents an N-terminal region of approximately 150 residues of a family of proteins of unknown function. It contains a highly conserved FPL motif.
Statistics
?
PSSM-Id: 401635
View PSSM: pfam09758
Aligned: 29 rows
Threshold Bit Score: 152.318
Threshold Setting Gi: 829189862
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002141277  131 IRSVAEILLWGDqNNEEGYFEVFCRYNILHKLVEIAVNSvfEYACRRQSLQTISILLQNIKTKQTLYYFLSNNTVIRLL- 209  Cryptosporidi...
Q38DZ2         42 LRELAQAIIWGD-KKNNASFDVFLELDMITTLESIVTNVesPSNVKAEVLRFVTLMLHNLTMKENVYYICSKNHLNKMI- 119  Trypanosoma b...
Q4DH52         42 LRELTEVLIWGD-KNAESVFDNFLERSMMSTLERVVTNAefPSAVKVQAIQCITMMLQNLTRKSSIYFVCSNNHLNRII- 119  Trypanosoma c...
A0ECA5         53 IRQIILYAIKGDnELHKQLFEQFMEIDVLNRLYDILQRRlcHHSLIQEIFEQVSSLLINVKEITNKNYILSHSSISNMVl 132  Paramecium te...
A0E1C4         36 IGQICQSVMWGD-KNNDTFFDYFCDQKTMSLYLDLVHTG--QREVVVAVIKAITMLLQNIQRPVSINYILSHSALNGII- 111  Paramecium te...
A0BDW0         27 IEELSEYFLFGD-HQKEEIFDYLAEHNILSLFYQKLKSA--NHQLTIFIIERTSMVITNLQNPLNINYALSNPALHDFI- 102  Paramecium te...
A0EEZ0         21 vSSLSELAILGD-QKESDLFDQFIEVKIIEEFVRILKSTk-DTNIVNTILHQISMLITNIGK--NIVVLLSLPQLNEFI- 95   Paramecium te...
A0C2E1         45 vELICEFSIWGD-QNNSDFFDYFFEENIAEKLLKIMQRSs-FKEIIIGIIQSFAILLANLTNKENVNYLLSHPVIQDLI- 121  Paramecium te...
Q7RJ79         23 LRKITQIIIWGD-KHDDQIFQYFCEDNIFTHFIYLLRQDi-NKTIRIQVYQSLTLLIQNLQKDISLYYIFSNNKINNLI- 99   Plasmodium yo...
Q4UF04         49 LKQLAEYLIWEDrTDQDYIFEYFCEENIMDYLTGVLCRSt-SRTVRIQLIQTISMLIHNIGKKKTLYYMLSNNYLNELI- 126  Theileria ann...
XP_002141277  210 -----D-EMYPVsqpyeysniclnevqiidEEEELLSYYVTLLRTMALLLNNETARFFYNDATNKFSLWIKACKYVNHKD 283  Cryptosporidi...
Q38DZ2        120 -----S-IDLNE------------------NDDELLSVYVSFLKSLALRCDETTVQFFFIRQLGVFPLFDYAAKLINTSD 175  Trypanosoma b...
Q4DH52        120 -----S-IFIDD------------------NDEELFSIYVSFLKSLALRLNEDTVQFFFERETRAFPLFDRASKLLAAPD 175  Trypanosoma c...
A0ECA5        133 wkqsfEqYQPNI---------------------EIVETYISFLNLLAVKLDDITTMFFINLKYPQFPLLWNAIRFYNHPE 191  Paramecium te...
A0E1C4        112 -----I-ADYNF------------------RDDEIIAYYINLLKCVSIRIDEQSLQLFYNLKFSTFPMLMKAICFYKHKE 167  Paramecium te...
A0BDW0        103 -----N-HNYDF------------------NNPEIVDYYVNFLKTIAIRINRENFYLYFNQRYCTFPLLWQAQKFIDYPD 158  Paramecium te...
A0EEZ0         96 -----I-YNYDL------------------TNDETQDYYINFIKILSNKVTRDNINLFFNQRYAQFPLLLYSQSFFNAKD 151  Paramecium te...
A0C2E1        122 -----M-YNYDF------------------TDEEIVDYYISLLKSLALRIDVDNVQLFFNQRMSVFPLLWQATKFYNHKE 177  Paramecium te...
Q7RJ79        100 -----Y-TTFIN------------------QDEDIIPYYISMIKSISFFLNYDTSKFFFNEKNKKFPLYTESLRLYKFND 155  Plasmodium yo...
Q4UF04        127 -----S-VPEIY------------------SGGDISSWTVSLLKTISSILDKSTIKFFFLQKNETFPLLDKSLLFLSSHD 182  Theileria ann...
XP_002141277  284 PMIRNTSRTVILN 296  Cryptosporidium muris RN66
Q38DZ2        176 RMARGAARQVVIS 188  Trypanosoma brucei
Q4DH52        176 PMVRAAARQVVIS 188  Trypanosoma cruzi
A0ECA5        192 LMVRNKSRSIVLH 204  Paramecium tetraurelia
A0E1C4        168 NLIRTSVRNIVLG 180  Paramecium tetraurelia
A0BDW0        159 ELVKNTSQNIVLS 171  Paramecium tetraurelia
A0EEZ0        152 NLTRTYTRHILLS 164  Paramecium tetraurelia
A0C2E1        178 IMVRTAVRTIILG 190  Paramecium tetraurelia
Q7RJ79        156 IITRTYVKNIILN 168  Plasmodium yoelii yoelii
Q4UF04        183 SMKRAHFMTIILN 195  Theileria annulata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap