5N9J


Conserved Protein Domain Family
Med10

?
pfam09748: Med10 
Click on image for an interactive view with Cn3D
Transcription factor subunit Med10 of Mediator complex
Med10 is one of the protein subunits of the Mediator complex, tethered to Rgr1 protein. The Mediator complex is required for the transcription of most RNA polymerase II (Pol II)-transcribed genes. Med10 specifically mediates basal-level HIS4 transcription via Gcn4, and, additionally, there is a putative requirement for Med10 in Bas2-mediated transcription. Med10 is part of the middle region of Mediator.
Statistics
?
PSSM-Id: 401627
View PSSM: pfam09748
Aligned: 100 rows
Threshold Bit Score: 87.9471
Threshold Setting Gi: 307103453
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5N9J_B        15 ASRLEDTTQAFYDLALIVYNLEDtTPSDAIPESLDTLIRDLKSLPDISR-----KVNNLIPQDVLEYIEQGRNPDVYARQ 89  fission yeast
XP_002112039  15 QQQIEQLCETSRQVGIIASDFQA-TSQKVLNDKLRGLITNLREINDMKEk----FDDIEVPLEVFSYIDEGRNPELYTKA 89  Trichoplax adha...
XP_003287426  35 lQTVEELVEELRRTIIVVEEFQS-QSQQLLFDKLNKIINLYEKIESNRNl----FNDVEIPLEIFRVIDQSKNPDLYVKE 109 Dictyostelium p...
EGF83434       7 evKLLQTLETLLKISMTVHDFQP-ESGPVLNTRIETLVQCLLDMNDAKA-----NTDIQVPFSLLEVVENGINPDQFTSD 80  Batrachochytriu...
XP_001765923  16 laSVHRALALLHQLQCSVSGFQL-PSQLVLLERLNGLVSEFGNMHSASQ-----DCHIQIPLEVLNFIDEGRNPDEYTKH 89  Physcomitrella ...
XP_006586005  46 SNSIQKTLGLIHQLYLTVSTFNA-AFQMPLLQRINGLVAELDNMVKLAE-----KCNIQVPMEVVNLIDDGKNPDEFTKD 119 soybean
XP_006660876  43 TASIQKTLGLLHQLNLNVSSFSS-ASQLPLLQRLNALVAELDTMQKLAE-----GCNIQVPMEVVNLIDDGKNPDEFTRD 116 malo sina
Q9FHZ2        39 iNSNQKILELLHQLKLTVSSFTP-ASQLHLLQRLNSLVMELDNMAKLSD-----KCNIQVPIEVLNLIDDGKNPDEFTKD 112 thale cress
1_pfamImport   1 KQNLNQVINSVDKTLEILHQFS--SFDFDVASHLNNFVFELDNMAKLGEk----CHNINVPMEVLNLIDDGKNPDEFTRN 74 
EFN51713      14 QDAIDRVLFKINELEAILGEFD--GNNELLHTKLNEYIEELTKLDAVKDnmigaGQQAELAVELLRAVDEGTNPDSFTVQ 91  Chlorella varia...
5N9J_B        90 FSEL-VQKDNQYVNGKLYAIEGFQKAFAEEIKQAYPEVSSVVDK 132 fission yeast
XP_002112039  90 CLDK-VVMMNQEMKGKVDAYKNFKTTLCEGLAKVFPKEMEAYle 132 Trichoplax adhaerens
XP_003287426 110 TLQN-CLAANEKTKGKIESIKNFKSELESHISESFKEEYEQYKl 152 Dictyostelium purpureum
EGF83434      81 LVQT-LVDKNQKTKGRIESIKILKDEIRTQLERNYPGLASELDN 123 Batrachochytrium dendrobatidis JAM81
XP_001765923  90 LLNG-CIQQNQASKGKVDSFKALRKHLLEQVEEVFPAETEAYRD 132 Physcomitrella patens
XP_006586005 120 VINS-CIVKNQITKGKTDALKSLRKHLLEELEHNFPDEVETFRe 162 soybean
XP_006660876 117 VINS-CIAKNQVTKGKTDAFKSLRKHLLEELEQAFPEDVEAYRE 159 malo sina
Q9FHZ2       113 VLNKnCIAKNQVTKGKSDAFKGLRKHLLEELEQAFPDEVDRYRD 156 thale cress
1_pfamImport  75 VLNN-CIAKNQITKGKIDIFKGLRGHLLEDLEQAFLEEVEDYRQ 117
EFN51713      92 LFRD-SMAQNQASKGKVEAFRMLQQRVSQQLQQAYPAVAADYQQ 134 Chlorella variabilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap