Conserved Protein Domain Family
Dymeclin

?
pfam09742: Dymeclin 
Dyggve-Melchior-Clausen syndrome protein
Dymeclin (Dyggve-Melchior-Clausen syndrome protein) contains a large number of leucine and isoleucine residues and a total of 17 repeated dileucine motifs. It is characteristically about 700 residues long and present in plants and animals. Mutations in the gene coding for this protein in humans give rise to the disorder Dyggve-Melchior-Clausen syndrome (DMC, MIM 223800) which is an autosomal-recessive disorder characterized by the association of a spondylo-epi-metaphyseal dysplasia and mental retardation. DYM transcripts are widely expressed throughout human development and Dymeclin is not an integral membrane protein of the ER, but rather a peripheral membrane protein dynamically associated with the Golgi apparatus.
Statistics
?
PSSM-Id: 401621
View PSSM: pfam09742
Aligned: 56 rows
Threshold Bit Score: 206.033
Threshold Setting Gi: 255070607
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q54JJ6         1 MGTGSSREQ---HLNSFNTLQKETVP------FSSDLWKtilSQN-LEDDSLYL--------ENLKKLKNERPENLATFI 62  Dictyostelium d...
XP_015794564   1 MGITNSALNn-lKSNEHLNKFASNQHipvgdsFWNEMLSfsfTKSiRTLEETRVledsvsplLNSLLSHNLNSNNLGSLV 79  two-spotted spi...
EJW84912       1 MGAKISSETl-iEENAYLRRFVGLQPisdndpFWNHFLSfnfLIDsNNRKEVEQfdislsdsLQSLMYNTPTTCNFASFI 79  Wuchereria banc...
CAP23760       1 MGSVITKETi-lQDNVYLKKLSGLEPvddydpFWNKLLSfslKFDdDDEKTRIAlesalddhLQCLMYNTQTTGNFAAFI 79  Caenorhabditis ...
XP_002128944   1 MGIGCSSFAh-lEDNEYLKRLSSNVSisendpFWNQLFSftlSAP-RDRNEAILleeatetfCKMLVDHNQHTGNFTSLL 78  vase tunicate
XP_003474101   1 MGSNSSRISd-lPKNEYLQKLSGTESvsendpFWNQLLSfsfPAP-TSSTELKLleeatisvCKCLVENNPRTGNLAALI 78  domestic guinea...
8_pfamImport   1 MGANSSSISe-lPDNEYLKKLSGAEPisendpFWNQLLSfsfTAP-TNSADLKLleeatisvCKSLVEKNPRTGNLGSLI 78 
Q28BM0         1 MGANSSTIKe-lSENEFLKKLSGTDSisenepFWNQLLSfsfSTP-TNSADSKLleegtlsiCKSLIENNPRTGNLGALI 78  tropical clawed...
XP_005931296   1 MGANTSQVSd-lSDNPSLKALVGTESisendpFWNQLISftfISP-TSSGESKLleeaviplAKILIENNPRTGNFGALV 78  Burton's mouthb...
XP_009022474   1 MGANNSTLSkdlSNNEYLLKLSGPDYispnepFWNQLLSfafSVP-KTSADQRHleditsnlCKNFAINNCRTGNFGSLI 79  Helobdella robusta
Q54JJ6        63 KKLVNQLVLVKG----LQREtntp------gdfQLTSISLsyLSRILPIVfesgddfadkvfwlnegieplshpsakist 132 Dictyostelium d...
XP_015794564  80 KIFISKSAALKDelnkEASQnii-------icqTFNSMFV--IRCCAKHL------------------------------ 120 two-spotted spi...
EJW84912      80 HVLLRRTAELKAs---EIYNntif------lwqTGNALIV--LRYICKFL------------------------------ 118 Wuchereria banc...
CAP23760      80 RLFLRRATELKTs---EQCEnenscfskiylwqTSNALLI--LRYIARFL------------------------------ 124 Caenorhabditis ...
XP_002128944  79 KVFLSRFSELKSs---AECDdqlf------iwqSRNAMFV--IQHLCKFL------------------------------ 117 vase tunicate
XP_003474101  79 KVFLARTKELKLs---AECQnhlf------iwqTHNALFI--ICCLLKIF------------------------------ 117 domestic guinea...
8_pfamImport  79 KVFLSRTKELKIs---AECQnhlf------iwqAHNALFI--ICCLLKVF------------------------------ 117
Q28BM0        79 RVFLSRTKELKIs---AECQnqlf------iwqAHNALFI--ICRLIKVF------------------------------ 117 tropical clawed...
XP_005931296  79 RIFLGRTKELKIs---TECQdqlf------iwqAHNALFM--IRCLLKVF------------------------------ 117 Burton's mouthb...
XP_009022474  80 RVFLMRANELSTs---ALCKddlf------twqTCNALFI--IRIVCKYF------------------------------ 118 Helobdella robusta
Q54JJ6       133 ppsitttktteiieEQEKKDQEnkqveenkeneekkdeekkdeekkdeekkdedkkenkttttttttnttnntnnNNNsd 212 Dictyostelium d...
XP_015794564 121 --------------VQTLTEENvlkhfl-----------------------------------------arkdgkEgn-- 143 two-spotted spi...
EJW84912     119 --------------VQRLSETEfikvfhmdk-----------------------------------tylekkdayDSDfe 149 Wuchereria banc...
CAP23760     125 --------------TQRMTEKEfvrifaknqenertessst---------------sssddeddddaqqtegsdnNNGet 175 Caenorhabditis ...
XP_002128944 118 --------------AENTTEMKmmeqfgar-------------------------------------slverqkdLTSgs 146 vase tunicate
XP_003474101 118 --------------ICEMSEEElqlhft-----------------------------------------yedkspGsy-- 140 domestic guinea...
8_pfamImport 118 --------------ISRMSEEElqlhft-----------------------------------------yedktpGsyg- 141
Q28BM0       118 --------------TSQISEEElllhft-----------------------------------------yrpadpGny-- 140 tropical clawed...
XP_005931296 118 --------------IREMSEAElhqqfs-----------------------------------------yqerapGscg- 141 Burton's mouthb...
XP_009022474 119 --------------IENLTEEVvvqqfe-----------------------------------------tinyteGtnq- 142 Helobdella robusta
Q54JJ6       213 essfdTTP-LAVKLMDSLLDLLFfpgfTVTeslglkspkeaspdaipvlfswaggfgvdsvptvhnKq-FWINRLSVLQC 290 Dictyostelium d...
XP_015794564 144 ----eTGVeVMESLINNLVSVLV----DIPl-----------------------------------SdsTYALHCECINL 180 two-spotted spi...
EJW84912     150 eefdgLCEnKAEELLDTLVDILV----DLPs-----------------------------------NdsTETIHIEAVKC 190 Wuchereria banc...
CAP23760     176 keaqiVFQnTAEEFTYELVSILF----NISv-----------------------------------NdtTLAIHVEAVRC 216 Caenorhabditis ...
XP_002128944 147 vfegtENVnYAHELLSALMDIII----HVPi-----------------------------------LdfTYSLHIEALNT 187 vase tunicate
XP_003474101 141 ---ssDSEdLLEELLCCLIQLIT----DIPl-----------------------------------LdiTYEISVEAIST 178 domestic guinea...
8_pfamImport 142 --samEERdVVQSLLCCLC--IS----VISl-----------------------------------LviSKHLHLPASAT 178
Q28BM0       141 ---esDTEnLFEELLFCLIQLIV----EIPl-----------------------------------LdlTYSILLEAVTA 178 tropical clawed...
XP_005931296 142 ---etGSEdLLEELLSNLVHLIV----EVPl-----------------------------------LdiTYSILFEAVTV 179 Burton's mouthb...
XP_009022474 143 ---leARDaLMEEFLNRLVYILI----DVPq-----------------------------------TdvTYSIHIECINI 180 Helobdella robusta
Q54JJ6       291 LITCLSEQLYVPqDSVSTF-K-SKWLDWITHTQEYyteALLFSLINTFATFDPI--------------GWGIpynhlMY- 353 Dictyostelium d...
XP_015794564 181 LLVLLSVQMYSV-KPASKSvIyRCIMK-KCAIHSL---LLTKCLINNFIRQDLPpre---------dgGSVI-------- 238 two-spotted spi...
EJW84912     191 LMVLLSSQLYDD-DVMRPNiFyRYLMQGKCSTRSL---ELSRALISNYLQRYTPcvvkh-----dkepESIV-----LG- 255 Wuchereria banc...
CAP23760     217 LLTLLSSQLYNE-SIVNTSiVfRFFIDGACAQHAA---KLTKTLLLNYLIHNSEyhmtv-----akpqESIV-----FG- 281 Caenorhabditis ...
XP_002128944 188 ILVLLSVQMFVP-SPGDNGpIyRILMTGQCAAKAN---NFMRALLQNFIEQRPSpeags----renggGSFV-----IGi 254 vase tunicate
XP_003474101 179 MVVFLSCQLFHK-EVLRQSiShKYLMQGPCLPYTS---KLVKTLLYNFIRQEKPpppgshvfsqqsdgGGLL-----YGl 249 domestic guinea...
8_pfamImport 179 MYVFLLCVLHAK-D-LRKGfSlSYSVQSSCAARSS---DCVLCLPHNNTXKTTPksssaysfpqifdsKKTK-----YYe 248
Q28BM0       179 LIVLLSYQLFRK-DILHESpIhRHLMKGPCLPYTS---RLVKTLLYNFIRQEKSpppgshifpqqqdgGGLL-----YGl 249 tropical clawed...
XP_005931296 180 LLVFFSYQLFHK-DILRDGiIyQHIMKGRCMCLTS---RLVKTLLYNFIRQEKCpppsthi-fepkaeGGLL-----YGl 249 Burton's mouthb...
XP_009022474 181 ILSLLSIQLFQM-SPASESmLhRCFMQGKCSRNSC---KLVKNLLETFTSQCRTnnn---------tpHGAL-----YGv 242 Helobdella robusta
Q54JJ6       354 -SDDH----------------------------EICSKLSIQILNVLLTYDPIENNDQqpqqqhhhhqqqhhqqqqqqqq 404 Dictyostelium d...
XP_015794564 239 -LDLAsglwsaltlgy-------gknnndetlkPVLSKLSLFLLLVLTYHCTTDS------------------------- 285 two-spotted spi...
EJW84912     256 ---LAasvwsavqivtgmddsnslssdseitppVSLGSLSVLLLLNLACHQDPEAKL----------------------- 309 Wuchereria banc...
CAP23760     282 ---LAssmwsmvqmatg-----ldsaeednkppLTLGNLCILLLLNLSCHQPVNAS------------------------ 329 Caenorhabditis ...
XP_002128944 255 aSAVAsglwsalklggkkd-sgvskeltselgpPTIGRQSALLILALINHQSYVDPTGqp-------------------- 313 vase tunicate
XP_003474101 250 aSGVAtglwtvftlggv-----gskaaasaelpSPLANQSLLLLLVLTNLTDAPDAP----------------------- 301 domestic guinea...
8_pfamImport 249 vIGVSpslwkvfnevgl-----csqetapsqlvVPVAASELMIVLICSQYRSLSDHP----------------------- 300
Q28BM0       250 aSGVAsgiwtvltlggv-----gskptpqqeqsSPLANQSLLLLLVLSNLTDAPDCP----------------------- 301 tropical clawed...
XP_005931296 250 aSGVAsglwsvftlgga----gsragidqehdpLPLSNQSLLLLLVLANLTDGPEWP----------------------- 302 Burton's mouthb...
XP_009022474 243 aCRFIsslwsvvtlgla----nqktehvvnesrAMLANQSLLLLLVLCNQFCSNGSFI---------------------- 296 Helobdella robusta
Q54JJ6       405 stiecrNKFIQYIKTLKRVR----------------DFKFFFNAFERIMNVplIASHTklpnstkkielhqdlTYTMWLF 468 Dictyostelium d...
XP_015794564 286 ------NPYREALFNCCDLQvdsigv-----aglvsGFKMNFNQLFSTLCAtqNEDQS---------------TLILYLL 339 two-spotted spi...
EJW84912     310 ------NPYKESLSKFQNSQevssln-----nsetdTFKLDYSLLYERLCAtvNQQSP---------------MLFLYIL 363 Wuchereria banc...
CAP23760     330 ------NPFKETLALFQNAQevstl------ptqviSFKIDYNGLYERLCAtaGQEPP---------------MLLLYML 382 Caenorhabditis ...
XP_002128944 314 ----fvNPYKAALCCFRHVQgqlqgpsngkqkgslpSFHINLSRLYGTACSvqVYESS---------------TLLLYSL 374 vase tunicate
XP_003474101 302 ------NPYRQAIMSFKNTQdsssfp-----ssiphAFQINFNSLYTALCEqqTSDQA---------------TLLLYTL 355 domestic guinea...
8_pfamImport 301 ------NPNANILMLKFSVSdssafs-----sshphVFQINFNSLYLKSCQksVSSNS---------------TVIVNFV 354
Q28BM0       302 ------NPFRQSVTFFRNTQdssvsp-----tpnphSFQINFNSLYTALCEqqKSDQA---------------TLLLYTL 355 tropical clawed...
XP_005931296 303 ------NPYRQAITCFRNTQdtsslp-----veqphTFQINFNSLYTALCEqqRSDQA---------------TLLLYTL 356 Burton's mouthb...
XP_009022474 297 ------NPYQTAFLSLHDDIpnaiet-----patrdHISVKFLDLYTTICStiKTDTC---------------TLLVYML 350 Helobdella robusta
Q54JJ6       469 LSYNHDFLRSIVN-YENSPEF-LIPLLQYMDEGR-------KSQTThgIVQIGTFILLLLSGERDFSISLNKP------- 532 Dictyostelium d...
XP_015794564 340 LYKNPSFRAFLISrTSQLDDL-TIPILKILYHSG-------EKTSH--HIYMAVIILLILSEDALFNESIHDItlkn-it 408 two-spotted spi...
EJW84912     364 LHRNVGFRNYILS-RINLEKL-VLPVLIVLSDGAqsssminSYNAH--HVYLALIVILILSEDDFFCKVAHETmikd-tt 438 Wuchereria banc...
CAP23760     383 LQANSGFRNYVLS-RINLENL-VVPVLRILHDGVa-----tSNNSH--HVYLALIVALILSEDDIFCKIIHETvpikdlg 453 Caenorhabditis ...
XP_002128944 375 LHGNPDVKAFVLS-KTDIDSL-VTPILQILYFAP-------SQNSH--HIYMALIILLMFTEDDHFNKYVHDIrlpt-vp 442 vase tunicate
XP_003474101 356 LHQNSNVRTYMLA-RTDMENL-VLPILEILYHVE-------ERNSH--HVYMALIILLILTEDDGFNRSIHEVilkn-it 423 domestic guinea...
8_pfamImport 355 LHLNS-LKSFLLKcRTVTLVLkVLPILEILYHVE-------ERNSH--HVYMALIILLILTEDDGFNRSIHEVilkn-it 423
Q28BM0       356 LHQNSNVRTYVLA-RSDMENL-VLPILEILYHVE-------DRNSH--HVYMALIILLILTEDDGFNRSIHEVilkn-it 423 tropical clawed...
XP_005931296 357 LHQNTNMRTYVLS-RTDMDNL-VLPILEILYHVE-------ERNSH--HVYMALIILLILTEDDAFNRSIHEVilkn-vt 424 Burton's mouthb...
XP_009022474 351 LHRVEPFKTYCLS-RTNIEQL-VLPILEMLYNSH-------EGNSQ--HLYMALIIILILSEDANFSLAVHDIpiskqip 419 Helobdella robusta
Q54JJ6       533 -F-VGRIHIDIQqpqvysDFVITVMYRLLVDTPDRLE------------------SIYECVLTILSNLSPYMKNLSMVTC 592 Dictyostelium d...
XP_015794564 409 wY-SERTLPEISl----gGLIILMIIRTVQYNISRTRd----------------kFLHTNLLATLANMSNHFRRLSPYVC 467 two-spotted spi...
EJW84912     439 wFnSERPLGEISl----gGLIILVFVRIIQLNTLKTKd----------------rYLHTNCLAALANMSSYFKNLSSIVC 498 Wuchereria banc...
CAP23760     454 wLdSDFSVREISl----gGLTALVFIRAIQKNALKTKvssvflfpntiplikqdrYLHTNCLAALANMSAFFKNLAPIVC 529 Caenorhabditis ...
XP_002128944 443 wY-TDRILSDISl----gDLIILVVIRTIQFNMSRMRd----------------rYLHTNCLAALANMSAHFRSLHPYAA 501 vase tunicate
XP_003474101 424 wY-SERVLTEISl----gSLLILVVIRTIQYNMTRTRd----------------kYLHTNCLAALANMSAQFRSLHQYAA 482 domestic guinea...
8_pfamImport 424 wY-AERVLTEISl----gSLLILVVIRTIQYNMTRTRd----------------kYLHTNCLAALANMSSQFRSLHQYAA 482
Q28BM0       424 wY-TERVLTEISl----gSLLILVVIRTIQYNMTRTRd----------------kYLHTNCLAALANMSAQFRSLHQYAA 482 tropical clawed...
XP_005931296 425 wY-TERSLTEISl----gSLLILVVIRTIQFNMTRTRd----------------kYLHTNCLAALANMSAQFRCLHQYAA 483 Burton's mouthb...
XP_009022474 420 wF-NERQLGEISl----gGLMVLVLVRTIQYNMTRMRd----------------qYLHTNCLGALANMSSHFMNLHPYVA 478 Helobdella robusta
Q54JJ6       593 VKLMKLFEYLSTPRFLF---ATNH----------------------------------------NYRYVGFLLESLNNLL 629 Dictyostelium d...
XP_015794564 468 QRLVTLFEKISKKLHKIlnsQNAIngnggdsgeklsdkdtd-------vastvgpldptqdtsiYEEVLRMLLEIMNSTL 540 two-spotted spi...
EJW84912     499 QKLIGLLEVFTRRHAKL---IENMrvraeydiiqek-----------------eshnyhkditaLEEGIRTLLEICNSCL 558 Wuchereria banc...
CAP23760     530 QRLISLLDLLTKRHAKM---VDHMrvssqndvagg------------------qpinfhdditaLEEGIRTLLEIINSAL 588 Caenorhabditis ...
XP_002128944 502 QRIFSLVTLLTKKYRKL---TEKVlaimatsdtpgtvsdasatsseqaeidmeperdyasnlkvLEEVLRMLLEIVNSCL 578 vase tunicate
XP_003474101 483 QRIISLFSLLSKKHNKV---LEQAtqslrgslssnd----------------vplpdyaqdlnvIEEVIRMMLEIINSCL 543 domestic guinea...
8_pfamImport 483 QRIIRLFGIFSELHNKA---LASAvqskpssltsns-----------------ipcvsqaqdlnIEEVIRMMLEIINSCL 542
Q28BM0       483 QRIISLFSLLSKKHNKV---LEQAtqslrgslgsde----------------splpdyaqdlnvIEEVIRMMLEIINSCL 543 tropical clawed...
XP_005931296 484 QRIISLFALLSKKHNKV---LEQAtqslrgrqgesa-----------------alpdyaqdlsvIEEVIRMMLEIINSCL 543 Burton's mouthb...
XP_009022474 479 QRLVSLFALLLKKHKKAadrLKEIaeiartnenki-------------------fipllqelavIEEVIRMTLEILNSCL 539 Helobdella robusta
Q54JJ6       630 Q-HQYESNTRLIYAILRCQNQFSKLAYLKIsPVTpskpmeqitqpspistseeafgklnklsiseepstlsneksdkttd 708 Dictyostelium d...
XP_015794564 541 S-SQLIHNPNLVYTLLYNRHVFEPFQSHPS-FQD---------------------------------------------- 572 two-spotted spi...
EJW84912     559 S-SNLRSNPHFIYTILYKRDLFDAFQNHPM-FQD---------------------------------------------- 590 Wuchereria banc...
CAP23760     589 C-GGLRHNTHLIYNLLYHRALFDAYVQHPM-FQD---------------------------------------------- 620 Caenorhabditis ...
XP_002128944 579 TgGALRHNANLVYALLQRREAFDQLRLHTV-YQD---------------------------------------------- 611 vase tunicate
XP_003474101 544 T-NSLHHNPNLVYALLYKRDLFEQFRTHPS-FED---------------------------------------------- 575 domestic guinea...
8_pfamImport 543 T-NSLHHNPNLVYALLYKRDLFEQFRTHPS-FQD---------------------------------------------- 574
Q28BM0       544 T-NSLHHNPNMVYALLYKRELFEQFRSHPS-FQD---------------------------------------------- 575 tropical clawed...
XP_005931296 544 C-NSLHHNPNLVYALLYKRELFEQFRTHPS-FQD---------------------------------------------- 575 Burton's mouthb...
XP_009022474 540 C-HSLNYNPNLVYTMLYQKEIFVQLSSHPS-FQD---------------------------------------------- 571 Helobdella robusta
Q54JJ6       709 ggdhqdesiskskvqskpttehpnstgatpsstnsgtptikafssttpnqespklggdgidsqsstpnkqqlpppppqqt 788 Dictyostelium d...
XP_015794564     --------------------------------------------------------------------------------     two-spotted spi...
EJW84912         --------------------------------------------------------------------------------     Wuchereria banc...
CAP23760         --------------------------------------------------------------------------------     Caenorhabditis ...
XP_002128944     --------------------------------------------------------------------------------     vase tunicate
XP_003474101     --------------------------------------------------------------------------------     domestic guinea...
8_pfamImport     --------------------------------------------------------------------------------    
Q28BM0           --------------------------------------------------------------------------------     tropical clawed...
XP_005931296     --------------------------------------------------------------------------------     Burton's mouthb...
XP_009022474     --------------------------------------------------------------------------------     Helobdella robusta
Q54JJ6       789 kktqmvshfmptdewlqdikkqlPLDNILKVITHLSPQIQGLCTGSGSDEQKIMDYLKMSTIVGifh---npgPIMTRRY 865 Dictyostelium d...
XP_015794564 573 -----------------------IIMNFDTVLTYFSNRIAAAEDSN-TSVAQVYEIIQNCSLQWpadk-mkkfPELKFRY 627 two-spotted spi...
EJW84912     591 -----------------------LIWNICAVISHFASRVQLLEKG--SSVSAILATIQKGVLHWptdr-lkkfPELKFKY 644 Wuchereria banc...
CAP23760     621 -----------------------LLVNIAAVISHFSSKVVHVPAGDG---MTMMQIIEKEANVWptdk-lakfPELKFRY 673 Caenorhabditis ...
XP_002128944 612 -----------------------VLQNIDTVINFFTGRLDQLNQQT-MTTDEVHSVIKDATVQLpshr-lhkfPDLKFRY 666 vase tunicate
XP_003474101 576 -----------------------IMQNIDLVITFFNSRLLQAGAE--LSVERVLEIIKQGVVALpkdr-lkkfPELKFKY 629 domestic guinea...
8_pfamImport 575 -----------------------IMQNIDLVESSVSFPLLQLNGHGQLSVERTLSSIGNEPLSMpkdgvdkkfPELKFKY 631
Q28BM0       576 -----------------------IMQNIDMVISFFSLRLEQAGAD--LSVERVLEVIKQGAVALpkdr-lrkfPELKFKY 629 tropical clawed...
XP_005931296 576 -----------------------IMQNLDTVIGFFSQRLEQAGSD--LSVERVQEVIMKGAQALpkdr-lkkfPELKFKY 629 Burton's mouthb...
XP_009022474 572 -----------------------IVFNIEMILNYFASCLEKQGGS--LSVTEVHALIKQAGLQFkkdr-lkkfPELKFRY 625 Helobdella robusta
Q54JJ6       866 HSNAITKSWFIAYMW 880 Dictyostelium discoideum
XP_015794564 628 VEDDQPEEFFIPYVW 642 two-spotted spider mite
EJW84912     645 VEDDNTVEFFVPYVW 659 Wuchereria bancrofti
CAP23760     674 VEDEYTVDFFVPYVW 688 Caenorhabditis briggsae
XP_002128944 667 VEEDSPEEFFVPYVW 681 vase tunicate
XP_003474101 630 VEEEQPEEFFIPYVW 644 domestic guinea pig
8_pfamImport 632 VEEEQPEEFFIPYVW 646
Q28BM0       630 VEEEQPEEFFIPYAW 644 tropical clawed frog
XP_005931296 630 VEEDQPEDFFIPYVW 644 Burton's mouthbrooder
XP_009022474 626 VEEERPEEFFVPYVW 640 Helobdella robusta
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap