Conserved Protein Domain Family
MCM_bind

?
pfam09739: MCM_bind 
Mini-chromosome maintenance replisome factor
This entry is of proteins of approximately 600 residues in length containing alternating regions of conservation and low complexity. The Arabidopsis protein is a replisome factor found to bind with the mini-chromosome maintenance, MCM-binding, complex and is crucial for efficient DNA replication. The family now spans the full-length proteins.
Statistics
?
PSSM-Id: 401618
View PSSM: pfam09739
Aligned: 43 rows
Threshold Bit Score: 547.223
Threshold Setting Gi: 575472582
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q55CZ6        45 FENVISEDQIYKSIPLVSTINQCDLNSGKLVKIRCMIQDIFDPQFCPSFNKIKNIETNE-IRLEASKYKDKINLN----D 119 Dictyostelium d...
XP_004346868 104 YLELLNDPSNYHRIPLVNNTPVSLLKPNTLVRFRCMIQDT-ADELSMGVAAFSVTDAAQqTRILSGLYRD---------- 172 Capsaspora owcz...
Q501D5        44 FRHYFSDESAISQVPILDSSSIKWVQPKTLVRFRGMIQDMLGNEFYAGAYKDD-------STWRTNKYSDVSQFPe--gS 114 thale cress
XP_006365988  44 FRKFLYDDGGLSQVPVLNPSSIARLKSNTLVRFRGMIQDMLGNELYVGMYKDG-------ETWRTNKFGDFFQFPmatgS 116 potato
XP_002274437  48 FRQFLFDNGGLSQVPVLNSTNFKRVQPNTLVRFRGMIQDMLGNELYVGVYKEG-------PNWRTNKFMDVSQFPm--gS 118 wine grape
EEF41557      44 FRHFLFDQSNLSQVPILNPASLRWIQPNTLVRFRGMIQDILGNEFYVGAYKDG-------SVWRTNKFMDVSQFPi--gS 114 castor bean
XP_003522508  44 FQHFLSDPSRLSQVPLLTPATIQWVKPNTLVRFRGMIQDMLGNEFYVGAYKDG-------SVWRTNKFMDASQSLt--aS 114 soybean
XP_009406879  48 FRDFLFEQGGLSQVPILDASTIRWVQPNTLVRFRGMLQDMLGNELYVGAYKDG-------STWRTNKFTDVAPSPm--pP 118 wild Malaysian ...
XP_015694686  43 FRSFLFEQGGLDKVPVLDESNLGLIKPNTLVRFRGMVQDMLGNEFYVGAFKDG-------STWRTNKFSDSSPFSm--pH 113 malo sina
XP_004968309  51 FRSFLLEEDGLDKVPVLNASNLGLIKPNTLVRYRGMVQDMLGNEYYIGAFKDG-------STWRTNKFTDFSPFSm--pH 121 foxtail millet
Q55CZ6       120 CEELIFDSfd--sSTFDKTILYCIPIPCENKWVNNNNnnnnnnnnnnnnnnnNNNNNGNEQISSSLLNKKKRNIddadmk 197 Dictyostelium d...
XP_004346868 173 -HESIDECdhgseSLISRQTFVGIPIPGEAPWVQEHHqala-------lyhgAVSSDPVATPAATPSVRSKRGY------ 238 Capsaspora owcz...
Q501D5       115 STEI---------QVWERRLLYCVPVPGKNQWTECSSq---------------ELKNRFLDL--TGQNREKRVRv----d 164 thale cress
XP_006365988 117 SPDM---------RVWERRLLYCVPVPGQNSWIEYSSe---------------SLLNPSSIS--SSPQREKRHRe----d 166 potato
XP_002274437 119 RPDM---------RVWERRLLYCVPVPGQNSWVEPSSe---------------AVINCYRNG--TSQQREKRQRd----d 168 wine grape
EEF41557     115 SPDM---------RIWERRLLYCVPVPGLNSWADSASe---------------VAGDTCMNW--TSQQRDKRGRm----d 164 castor bean
XP_003522508 115 SADM---------RIWERRLLYCVPVPGLSPWTQVSTe---------------EFGHLSMDR--TSENREKRRRe----d 164 soybean
XP_009406879 119 AFET---------QLWERHLFHCVPVPGQNSWTMEPSp---------------SPGERNMSSS-ASQHGVKRGR------ 167 wild Malaysian ...
XP_015694686 114 PCDS---------HLWERHLFHCVPVPGQNSWTHESSp---------------GPDVRRMSSCLTSEQREKRKR------ 163 malo sina
XP_004968309 122 PCDS---------HLWERHLFHCVPAPGQNSWTMESSp---------------GPDLRRMSSCLATELREKRKR------ 171 foxtail millet
Q55CZ6       198 NENDEENKKSKDqkstttttt---ttskegeeeGEEGEQLTKSKKLLTNNKIDINKIFN-YPIPidsndeNNLKTPFIVN 273 Dictyostelium d...
XP_004346868 239 EEDDEPAEPSLMlptsnivpp---svakrvqsvADRAQLDRVTSQQANTPLSVADALSTcFPVPy-----QQAGPVCHIK 310 Capsaspora owcz...
Q501D5       165 EEMTDSMDSSTLeagrngspf---kkmkvgeatSSASESQVPQTSGIPPATS-------------------ADSLPCLVK 222 thale cress
XP_006365988 167 DTAMDDIDMQVTneevqastsn--kkmredgitSNSSNLGDTPTADIGSATSVLPYF-------------DRNSLPCLVK 231 potato
XP_002274437 169 NTATDPMELHVSddefqgsssn--kklregelpFESSKAQDFVSESACSSVSMVPTF-------------DKDSLPCLVK 233 wine grape
EEF41557     165 FEAADHKDSHred-----------------ghpSPYSDSQDCKTAGACSSKIMLSDI-------------NKNSFPCLVK 214 castor bean
XP_003522508 165 DESSD---MPVSgdevqnspnt--krmregehsSLASNSRGAATEIASSGTSLVSGL-------------DSNSPPCLVK 226 soybean
XP_009406879 168 -NTEDDMDLNVSyngdegssnmkkqkedestcqSSGSSEDLVKHGGDLLLKNGD-----------------SSCLSCLVK 229 wild Malaysian ...
XP_015694686 164 -GAEND-AMEVSencngeasct-kkpkdddaqiSNSSPEVSMNEEHVPEMNGGDHHI-------------PGSSFSCLVK 227 malo sina
XP_004968309 172 -DGDKD-DMDVSengheessalckkpkeddvhvSSGSNEVA---EGVPEMNRGD-HI-------------PGSSFSCLVK 232 foxtail millet
Q55CZ6       274 IYDDDiifdennkavTFKINEIIEFVGVVAkFNPTLQHQSSnssdqgettttiidlmsmldVDEISTI--------PDTL 345 Dictyostelium d...
XP_004346868 311 IYHGYd---------DVKVASVLDVVGILTf-----------------------------eQDHFEEPvfeheefrPSSL 352 Capsaspora owcz...
Q501D5       223 IYDSPe--------sDLKLNDVVEFLGVLT-FDPIVMMDTDtlden----------sdalsEAESVQM--------PSGK 275 thale cress
XP_006365988 232 IYDSPe--------sDLKLNDVFEFIGVLT-FDPEFSVDKNvdndil---------gylgdDDTQTQM--------PPTK 285 potato
XP_002274437 234 IYDSPe--------sDLKLNDVFEFVGVFT-FDPELVV-KDdtdef-----------sdlcDDVLANL--------PPSK 284 wine grape
EEF41557     215 IYDSPe--------sELKLNDVFEFVGVLT-LDSDLAMEKDdhddl----------sndfgDDVSIHL--------PPNK 267 castor bean
XP_003522508 227 IYDSPd--------sELKLNDIFEFVGILT-SDLELEEDNEdcdls-----------dgisEDPLCHL--------PPSK 278 soybean
XP_009406879 230 IYDMPe--------sHLKLNDVFEFIGIYT-FDPELAGHKDnsddl----------mydlfEDPMAHL--------PPSK 282 wild Malaysian ...
XP_015694686 228 VYDMAe--------sQVKLNDVAEFIGVYT-FDPELASPSDnsddi----------mfdliEDVTAQL--------PPSK 280 malo sina
XP_004968309 233 VYDMPd--------sQVKLNDVIEFIGVYT-FDPELAAPSDnpddi----------mldliEDVIVQL--------PPSK 285 foxtail millet
Q55CZ6       346 IPQFHAITYRYLDpykfnHLNPFSidtnttinnnnnnnnnnnnnnnnnnnnnnnnnnnnnNPNNNNPNNNNLNNNLIRNE 425 Dictyostelium d...
XP_004346868 353 VPRIHCITFTMPK-----STNPLVpha-------------------------------qsAVFAGERLAIAAQAQMLRSH 396 Capsaspora owcz...
Q501D5       276 VPRLHCLIHRKLEtqhflHGSSLL-----------------------------------------PEPKSPQIFKEIRES 314 thale cress
XP_006365988 286 VPRLHCLIHKKLSnqdfiTGSPTL------------------------------------------ELK-SHLVKEIRET 322 potato
XP_002274437 285 VPRLHCLIHRKLAvhdfiSNSPVM------------------------------------------EVK-PHLVKQIRES 321 wine grape
EEF41557     268 VPRLHCIIHRKLAvadflHSSPII------------------------------------------EPK-PHFIKAMREA 304 castor bean
XP_003522508 279 VPYLHCFIHRKLAvhdflQHNPIV------------------------------------------EPR-PNLVREIREA 315 soybean
XP_009406879 283 VPRLHCLICRKLViqdflPNSPVI------------------------------------------EPL-PNMIRKIRES 319 wild Malaysian ...
XP_015694686 281 VPRLHCLVWRSLSahdflSRSPAV------------------------------------------EPS-PILLKGIRQS 317 malo sina
XP_004968309 286 VPRLHCLVWRKLSphdfiSRPPVV------------------------------------------EPS-PSILKGIRQS 322 foxtail millet
Q55CZ6       426 LIKFI-KLFIVDELLSEYLLFHLISKVYSFTSGLSIGNFSMNIS-IPn---------DKEFQRLPQLIELLYEILLARSY 494 Dictyostelium d...
XP_004346868 397 AVDVFaNILLGDQLAAEYLLLHLLSNVYVRRQLMACGKLSLNISnIPdlaesgmpsiaSSANGLVNALARTVGALVPNSL 476 Capsaspora owcz...
Q501D5       315 LMKYLtGLLGNDHIAAQFLLLHLLSKVHGRVDNVAVGKLSLNLIhLN----------KESMSIFGTQLSGALKSLLPFTQ 384 thale cress
XP_006365988 323 LLRHLtTILGNDGVAANLMLLHLLSKVHARVDSTAVGKLSLNLTcFN----------KETLSVYGHRLNLALKNLLPFTH 392 potato
XP_002274437 322 VLGHLtAVLGNDGLAAHFMLLHLLSRVNGRVDTLAVGKLSLNLTcFN----------KESVSVFGNQLTLAIMNLLPFTH 391 wine grape
EEF41557     305 LLRHLtAILGNDGVAATFMLLHLLSRVHARVDNVAVGKLSLNLTcLS----------KESISIFGTQLSIAVKNLLPFTS 374 castor bean
XP_003522508 316 LLRHLtAVLGNDDFATHFMLLHLLSNVHARADDLAVGKLSLNLTcFS----------KEIVSVFGKPLSAALKNLLPFTF 385 soybean
XP_009406879 320 LLLHLsAVLGNDEVAAQYLLLHLLSRIRAQVDVITVGKLSLNLTgFT----------RESASIFGCQLTNAVEELLPFTR 389 wild Malaysian ...
XP_015694686 318 LLSHLtLVLGNDELAAQCLLLHLLSRLRNKVDVVTVGRLSMNFTgFN----------RESVSVFGNQLNNLIQRLLPYSQ 387 malo sina
XP_004968309 323 LLSHLtLVLGNDELAAQCLLLHLLSRLRNRVDLVTVGRLSLNFTgFN----------RESASIFGNQLYSLIQKLVPYSQ 392 foxtail millet
Q55CZ6       495 RFSMSLENLNDMDVVPYKDYDRNRIVSGLLQLPKGTNLILDETQLTEGKVESQGIKVLNALNTLSIQQKVEYDFKYHPIE 574 Dictyostelium d...
XP_004346868 477 LLPLTVNNLNTLRFRPFKNHTLGKLESGVFQLPHHTHLLVDETSLQPAQLEPRGTENCNTISNLLQWQSLEYDFEYHNIT 556 Capsaspora owcz...
Q501D5       385 SIPLTIEYLNTASFGPKKDYGINRLMPGVLQIADGTHLILDETELQPGTLNSVGVENANLLKNLLECQKVEYDFQYYKME 464 thale cress
XP_006365988 393 CVPLTVDYLNKIPLAPKKNYQTNRLASGILQLAEGSHLTIDETQLQEGRLNPIGLENARVLQSLLEQQKVEYDFTYYKMD 472 potato
XP_002274437 392 RIPLTVDYLNSASLAPKKDYQLNRLVTGVLQLAEGSHLTIDETQLKAGTLNSVGVENARLLKNLMQLQKVEYDFKYYKME 471 wine grape
EEF41557     375 CIPLTVEYLNRSSLAPKKDYQSNRLMPGVLQLADGSHLIIDETQLETGTLNSVGVDNARLLKNLIEFQKVEYDFTYYKME 454 castor bean
XP_003522508 386 YIPLTVEYLNTVSLVPKKNYDTNRLETGVFQLAEGSHLIVDETKLEAGTLNSVGVENTRLLKNLMELQKVEYDFKYYKVD 465 soybean
XP_009406879 390 AIPLTIEYLNNATLQPRKDNKTGRLVAGVLQLAQGTHLTIDETRMQNGTLNSNGVENARLLKHLLEWQKVEYDFEYYNLE 469 wild Malaysian ...
XP_015694686 388 TIPLSIEYLNTATLQPRKDNHSGRLVTGVLQLPQGTHLTFDETLLQSGSLTSKGVENTMLLKNLMESQMVEYDFEFYKLE 467 malo sina
XP_004968309 393 AIPMSIEYLNTATLQPRKDNKSGRLVTGVLQLPQGSHLTFDETLLQTGSLTSKGVENTMLLKNLMESQKVDYDFEYYKLD 472 foxtail millet
Q55CZ6       575 IQTDLPTISISFGKS-LIKGTTQISINKSIQLPTINEINQQLIhsyNNDKLNQFRNYINHCKNLSFKIsspttttiaeSD 653 Dictyostelium d...
XP_004346868 557 FNTDLQVLITSSGKS-MFPADCHVPLEPVTSGVVDVLAQMDAA------TLERLRLYLTMARDFDYSF-----------E 618 Capsaspora owcz...
Q501D5       465 MATDVQMLIFSEGKSnIMPADLVLPLQPSQVNSLEv---------iTPETAETWRCYLATCKSLSHSI----------GQ 525 thale cress
XP_006365988 473 MPADIQLLVLSEGKSnILPADLVLPFRPLSVDAAQd---------vEIEVLQSWRWYLATMRSLSHSI----------TQ 533 potato
XP_002274437 472 MAADVQLLILSEGKSnILPADLVLPFQPSSVDSTEp---------vATEALEAWRWYLVTLRLLPNSI----------DP 532 wine grape
EEF41557     455 MAADVQLLILSEGKSnILPADIIIPFQPSSASSSEv---------vVTDSLNAWRWYLATVRSLPHSI----------ES 515 castor bean
XP_003522508 466 MATDFQLLVLSEGKSnILPADVIVPFRPSATSCSEa---------vTAEALEAWRWYLATVRQLSHTI----------EP 526 soybean
XP_009406879 470 MAADVQLLIISEGKSnILPADLVLPFCPKSVDSVNa----------TGEKLQAWRWYLATMRSLQHSS----------EP 529 wild Malaysian ...
XP_015694686 468 MATDVQLLTLSEGKSnILPSDLIVPFRPSSVPAVNa----------SSEELESWRWYLATVRSFPQST----------ET 527 malo sina
XP_004968309 473 MATDVQLLTLSEGKSnILPSDLVVPFRPSSVPTIDa----------GSEELENWRWYLATVRSLPQST----------EP 532 foxtail millet
Q55CZ6       654 DATRHIQEDFVKSRQLDSkMTTDVFHYWLTLSRLVALSFNDQYIKIDKWNIMKSLEEKRK 713 Dictyostelium discoideum
XP_004346868 619 QLESEVQNDFVAMRRADRtVTQETFSQLLVVSRLLSLSYGQPQLTPACWQRAKELEQLRV 678 Capsaspora owczarzaki ATCC 30864
Q501D5       526 ELQQVVENDLVAARQTDRsLGSQDLSRLLTMARMMSVSYGETTLSLEHWQMVLELERLRK 585 thale cress
XP_006365988 534 EMQKVVEDDLVAARQADRsLGSLDFSRFLTMGRLVSLSFGETTLTLEHWQMAKELERLRK 593 potato
XP_002274437 533 ELQKVIEDDLVAARQADRtLSSQDFSRLLTMGRLMSLSYGETSLSLEHWQMVKELERLRR 592 wine grape
EEF41557     516 EIQKVIENDLVAARQADRsLGSQDFSRLLTMGRLISASFGETSLSLEHWQMVKELERQRR 575 castor bean
XP_003522508 527 EMQKVVETDLVAARQADRsLSSQDLSRLVTMGRLMSLSYGETSLSLEHWQTVKELERLRR 586 soybean
XP_009406879 530 ETSQILQDEMVAAMQEDRsLGCSGLTRWLTMAELMSASFGEKCLTLEHWQMIKELERLRK 589 wild Malaysian banana
XP_015694686 528 ETYQTIQDEMVNAMRDDRnLGCSELSRWLTMAQITAASFGETSLSMEHWQMVKELERLRK 587 malo sina
XP_004968309 533 ETYQMIQDEMVSAMRDDRsLGCSELSRWLTMAQIMASSFGEKSLSLEHWQMVKELERLRK 592 foxtail millet
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap