Conserved Protein Domain Family
Det1

?
pfam09737: Det1 
De-etiolated protein 1 Det1
This is the C-terminal conserved 400 residues of Det1 proteins of approximately 550 amino acids. Det1 (de-etiolated-1) is an essential negative regulator of plant light responses, and it is a component of the Arabidopsis CDD complex containing DDB1 and COP10 ubiquitin E2 variant. Mammalian Det1 forms stable DDD-E2 complexes, consisting of DDB1, DDA1 (DET1, DDB1 Associated 1), and a member of the UBE2E group of canonical ubiquitin conjugating enzymes and modulates Cul4A function.
Statistics
?
PSSM-Id: 401616
View PSSM: pfam09737
Aligned: 33 rows
Threshold Bit Score: 435.918
Threshold Setting Gi: 74869615
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015795436 133 RECSLFTFDSRYVIVASSAP-----IIDM--PNYYDVLRNNESVsvnvkffcEDYIIYLIDIKNGKKCDQIVLKTDNISL 205 two-spotted spi...
XP_002049492 150 REFSVFLEDSRYVLLAGMCIlqgcnLAVSdyERYPDVFDKVDPF---------SYIFYVVDLQQGVVTDEVRLPQDAISL 220 Drosophila virilis
EDW00670     148 REFSVFLEDARYVLLAGMCIlqscnVSVSdyENYADIFDKVEPF---------SYIFFVVDLQQGIVTDEVHLAQDVISL 218 Drosophila grim...
XP_002014308 150 REFSVFLENGRYVLLAAMCIlh-gaLATAdyISYPDLFDKLDAF---------SYIFFVVDLVLGVVTDRLFLPQDSIVI 219 Drosophila pers...
XP_001963225 148 REFSVFLENGRYVLLAAMSVlr-naLPTMsyVLYPDLFDKLDAY---------SYVFFVVDLEKDCVTHRLFLSQDSIVI 217 Drosophila anan...
Q658D0       123 KDFFLYMECHQFGLFATSTA-----QSNDs-SATEGAIHGVPSI--------EKITFYLVRLDDGAILDEKAFRNDFINL 188 Japanese rice
EEF43016     158 KDFFLYVESSQFGVFATSTA-----QFHDt-PAIGGAIQGVPSI--------ERITFHLLRLEDGEILDEKVFQNDFINL 223 castor bean
KRH77746     121 KDFFLYMESNQFGLFATSTA-----QIHDa-PAVGGAVHGVPSI--------EKITFHLLRLEDGEILDKKVFSNDFVNL 186 soybean
Q9ZNU6       121 KDFFLYMESNQFGLFATSTA-----QIHDa-PPTGGAIQGVPSV--------EKITFHLLRLVDGAILDERVFHNDYVNL 186 tomato
P48732       122 KDFFLYHQTRRFGLFATSTA-----QIHDssSPSNDAVPGVPSI--------DKITFVLLRLDDGVVLDERVFLHDFVNL 188 thale cress
XP_015795436 206 PHNQGLYLYDDILAILSVQHQTIYLYRLDdckiVGKtFIEVN-SIGRFCYDDDPFVSTLHNTETRplspss--------- 275 two-spotted spi...
XP_002049492 221 SHNHGISVHGHTIAILSRLRQSIYIYELV----NGR-LIKQEhEIGPR--PLHCAFQDVSSMFMVm-------------- 279 Drosophila virilis
EDW00670     219 SHNQGISVHGSTIAILSLLRQAIYIYELV----NGR-LIKQEhEIGPT--PANCAFEDLSPVEAVtfdv----------- 280 Drosophila grim...
XP_002014308 220 GHNHGISVHDSLVAIMSRLYQCIYIYEVV----AGR-LVKRE-TIGPR--PRG--FIDEVSSDIGvlda----------- 278 Drosophila pers...
XP_001963225 218 AHNHGISVFGSTIAIMSRLHQCIYVYELV----EGR-LVEQE-TIGPR--PRD--FIENASMDVGnlda----------- 276 Drosophila anan...
Q658D0       189 AHSIGAYLYEDLLCIVSLRYQTIHVLQIRd---SGN-LVEVR-KIGAFCQEDDELFLHSHG------------------- 244 Japanese rice
EEF43016     224 AHNMGVFLYDDLLAIVSLRYQTIHILQIRe---SGN-LVDVR-AIGAFCREDDELFLNSSAQFTVipdkskmhqp----s 294 castor bean
KRH77746     187 THNMGVFLYDDLLAIVSLRYQTIHILQIRd---SGN-LVDVR-AIGEFCREDDELFLNSNAQGMAfsdknkqlql----p 257 soybean
Q9ZNU6       187 AHSIGAFLYDDLLAIVSLRYQRIHILQIRd---SGD-LVDVR-AIGEFCREDDELFLNSNSQVLVnhvg----------- 250 tomato
P48732       189 AHNMGVFLYDDLLAILSLRYQRIHLLQIRd---SGH-LVDAR-AIGYFCREDDELFLNSSSQAMMsqdkskqqslsgske 263 thale cress
XP_015795436 276 --sdssnaSASSYldsqfdtptHPYHE-VSFCAMKHRILAFFYRQAQSQAKEK--SNPELLLTFYRKFDEYCGLRMSKMQ 350 two-spotted spi...
XP_002049492 280 ---------------------lDVNTL-LPITHIKQRVLSFLYRQIQPDSP----QASQKYQDFYKNFDFIENMIIEKMQ 333 Drosophila virilis
EDW00670     281 -------------------------ntlLPITHIKQRVLSFLYRQIQPGSP----EAIESLKEFYKNFEYIENMIIEKMQ 331 Drosophila grim...
XP_002014308 279 -------------------------ntiLPITHIKQRVLSFLYRQIDANSS----RSSQRYQDFYKNFDFLEHMIMEKMQ 329 Drosophila pers...
XP_001963225 277 -------------------------ttvLPITHIKQRVLSFLYRQINVEAP----GAKQKLQDFYKNFEFVEYMIMERMQ 327 Drosophila anan...
Q658D0       245 ----------------------QAARGvSFLPGIKQRLLSFIFRKTWNEESDQtlRVQHLKKKFYFHFQDYVDLIIWKVQ 302 Japanese rice
EEF43016     295 rnhiennvPS--T---------QPTSDnSFLSGIKQRLLSFIFRGIWNEDRHKttRVQCLKKKFYFHFQDYVDLIMWKVQ 363 castor bean
KRH77746     258 gnhienhmHQ--G---------QPNLGnSFLSGIKQRLLSFIFQGLWNEERDDtlRIQRLRKKFYFHFQDYVDLIIWKVQ 326 soybean
Q9ZNU6       251 -----ngfHH--S---------LPQSEtSFLSGIKQRLLSYIFRGIWNEA-DQtmRVQCLKKKFYFHFQDYIDLIIWKVQ 313 tomato
P48732       264 ddtgenglRHSLS---------QPSGSnSFLSGVKQRLLSFIFREIWNEESDNvmRVQSLKKKFYFHFQDYVDLIIWKVQ 334 thale cress
XP_015795436 351 LLDRDHLLIKYE-----FGELVAQRLGDQT-GFT-SYFVFYQISKAKILDIYSNTSNELAQLFENYCDYFRNT--HTlyn 421 two-spotted spi...
XP_002049492 334 LIDSDFLLLRYEer-pkDSDVTPILVTGEP-QPPrRLYVFYAMSSEEVLGVYHDDSVDLLQIVVQFYDKLCNVrsLQtgd 411 Drosophila virilis
EDW00670     332 LVDNDLLLLRYEer-pkD---TPNLITGEQfEPRrRLYVFYDISKEQVLGVYHDDSVDLLRIVVQFYDKLCNVrsLQtgd 407 Drosophila grim...
XP_002014308 330 LVNSDLILLRFEer-pkDNDITPLLTLGEI-PTPrRFYVFYTILGEQVMGVYQDDSVELLQIILQFYDQMRNVrsLHtgd 407 Drosophila pers...
XP_001963225 328 LVNKELLLLRYEernrtDSDVTPLL------PSPrRLYVFYNIASEEVVGVYHDDSVDLLQIILQFYDQMSNVrsMQtgd 401 Drosophila anan...
Q658D0       303 FLDRHHLFIKFG-----SVDGGVSRSTE---QNS-AFFAVYNMETTDIVSLYQNSSEELYSLFEYFYDHFHTNpqNSshg 373 Japanese rice
EEF43016     364 FLDRHHLLIKFG-----SVDGGVSRSAD---HHP-SFFAVYNMDTTEIVAFYQNSADELYLLFEQFCDHFYATsrNSlhm 434 castor bean
KRH77746     327 FLDRHHLLIKFG-----SVDGGVSRNAD---HHP-AFVAVYNMDTTEIVSFYQNSADELYLLFEQFCDHFHATsrNSmym 397 soybean
Q9ZNU6       314 FLDRHHLLIKFG-----SVDGGVSRNAD---IHP-SFFAVYNMETTEIVAFYQNSADELYFLFELFSDHFHVSskSSlhm 384 tomato
P48732       335 FLDRQHLLIKFG-----SVDGGVTRSAD---HHP-AFFAVYNMETTDIVAFYQNSAEDLYQLFEQFSDHFTVSs-STpfm 404 thale cress
XP_015795436 422 qaicsSTNNFYARECLHrFKN--I--TNRDHGSEETTRRVLSLLPLSAQSYTPSPYLDLSLFKYDDRWISPLERPKVCSE 497 two-spotted spi...
XP_002049492 412 a-pssPSSHYF-------MQQncInpNKSAPFMRQAALRYNPTVPVSTQSFSTSPYLNYNVFSYDDKLISPLERPKACSV 483 Drosophila virilis
EDW00670     408 a---pssSHHF-------MQRycTnpNKTALIMRQAALRYNSTVPISTQSFSTSPFLNYNLFKYDDRLVSPLERPKACST 477 Drosophila grim...
XP_002014308 408 a-pslP-PQFF-------LKQnfVdaNKTINFMRQAALRFNPSVPVSTQSYSPSPYLKYNEFSYDDRLISPLERPKPCSA 478 Drosophila pers...
XP_001963225 402 a-pslP-LHFF-------LKQnfAdaSESIPFIRHAALRFNSSVPVSSQSLSPSPYLQFNEFSYDDRHISPFERPNPCST 472 Drosophila anan...
Q658D0       374 nfissHSNNVHALDQLRt-----I--KNKANSTSQFVKKMMASLPYTCQSQSPSPYFDLSLFRYDEKLISAIDRHRHCTE 446 Japanese rice
EEF43016     435 nfissHSNNIHAFEQLRt-----I--KNKASSFSQFVKKMLASLPFSCQSLSPSPYFDQSLFRFDDKLISATDRHRPSTD 507 castor bean
KRH77746     398 nfissHSNNIHALEQLRs-----I--KDKASSSAQFVKKMLASLPFSCQSQSPSPYFDQSLFRFDDKLISATDRHRQSTD 470 soybean
Q9ZNU6       385 nfmssHSNNIHALEQLRc-----T--KNKATNFSQFVKKMMASLPCSCQSQSPSPYFDQSLFRFDEKLISAIDRHRQSTD 457 tomato
P48732       405 nfvtsHSNNVYALEQLKy-----T--KNKSNSFSQFVKKMLLSLPFSCQSQSPSPYFDQSLFRFDEKLISAADRHRQSSD 477 thale cress
XP_015795436 498 YAIQFFS-RSDGSFRFQIHADRQHIEASLVTLRLVAYTFHPTDPFALSIQRTS--SDIAVHLHFR 559 two-spotted spider mite
XP_002049492 484 EPIVFRD-RATNLIKFRFNTKAHRPPSQFTPRELCAFICHPFEPLVLSIQKCM--HVYSYKLHIY 545 Drosophila virilis
EDW00670     478 EAIVFRD-PETNLIKFRFDVKARR--STLTPRELCAFIYHPFEPLVFSLQKCM--HVYACNVHIY 537 Drosophila grimshawi
XP_002014308 479 EPIVFRD-RTTKLVKFRLSAKARRQNNPLAPRELCAFICHPFEPLILSIQKYS--HIYAYNIHLY 540 Drosophila persimilis
XP_001963225 473 EPIVFRD-RMTKSVKFRLYAKARRPVSSLSPRELCAFIWHPFEPFVLSIQKCM--NSYAYHVHLY 534 Drosophila ananassae
Q658D0       447 HPIKFISvKQPNVVKFKIKPGSDSGASDSRAKRISSFLFHPFFPLALSIQQTYm-QPTVVNLHFR 510 Japanese rice
EEF43016     508 HPIKFISrRQPCVLKFKIKPGPEAGSIDGRTKKVSSFLFHPFLPLALSIQQTLfmQPS-VNIHFR 571 castor bean
KRH77746     471 HPIKFILrRYPYSLKFKIKPGPEAGSMDGRAKKISSFLFHPILPLALSVQQTLflQPSVVNIHFR 535 soybean
Q9ZNU6       458 HPIKFISrRQPNILKFKMKPGPEAGSTDGRTKKICSFLFHPILPLALSVQQTLflQASVVNIHFR 522 tomato
P48732       478 NPIKFISrRQPQTLKFKIKPGPECGTADGRSKKICSFLFHPHLPLAISIQQTLfmPPSVVNIHFR 542 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap