3P8C


Conserved Protein Domain Family
Nckap1

?
pfam09735: Nckap1 
Membrane-associated apoptosis protein
Expression of this protein was found to be markedly reduced in patients with Alzheimer's disease. It is involved in the regulation of actin polymerization in the brain as part of a WAVE2 signalling complex.
Statistics
?
PSSM-Id: 401614
View PSSM: pfam09735
Aligned: 27 rows
Threshold Bit Score: 1184.36
Threshold Setting Gi: 284086991
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3P8C_B     13 LAEkltilndrgvgmltrlynikkacgdpkakpSYLIDK---NLESAVKFIVRKFPA---------VETRNnn--qqLAQ 78  
EGD73771   13 FAEkltilndhgkgilck-lyhtkrllqheqppSVLIEK---TFESQVKAALKKFPN---------VDSLKe----rDSF 75   Salpingoeca rosetta
Q6ZBH9     88 FSE------------------------------AFWKAGvmpNFPKICITLSKKFPEhpnklqlekVDKFA------LDA 131  Japanese rice
EFC40664    4 VAEklfvlkqhseallqrlytiknelgdndlkpDIMKSTlpvDMKKMFAKLLKDAPHi-------aIDELEkv--qgFDW 74   Naegleria gruberi
EGC34074    6 IPEkfqlllengeniltrvyntrllfqnnkvkpSFIIDE---KISKILKNLIAKYPE---------LPENNdksiqgFDL 73   Dictyostelium pur...
EFA80340    7 IPDkihvltengeqllhrlynsrqilqgaktrpLFLNDE---KVGRAIKNLMSKFPD---------FPELDki--qgVEL 72   Heterostelium alb...
A7RU46     12 LAEkltilnergegmltriynikkacsdpksrpGFLMDK---ALEPSIKYIVRKFPQ---------MDTKAt----qLQA 75   starlet sea anemone
EJD74871   12 IAEkliilndravgmltrlynikkacgdpkskpQFLSEK---SLENCIKHIVRKFPI---------VDARSss--tlFHQ 77   eye worm
P55163     11 IAEklvilndraagmmtriynikkssgdskvkpQFLSDK---KMEGAIKHIVRKFPV---------VDCRSns--stFEY 76   Caenorhabditis el...
Q5S2C4     99 FSE------------------------------AFWKAGvfpNHPRICTLLSKKFPEhfsklqlerIDKFS------LDS 142  thale cress
3P8C_B     79 LQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVFFDI--TVNFDLTKNYLDLIITYTTLMILLSRIeERKAI 156 
EGD73771   76 TSARREELMNTLQPHYYNLVDAMDFQDRVKEVVASMSACQMRLQL--NLNYRLTALFLDLLHTYVAVILLLFRLdSRRMI 153  Salpingoeca rosetta
Q6ZBH9    132 LNENAEGYMQNLEQWITLLLDLLEFREQALRLILDLSSTVITLLP--HQNSLILHAFMDLFCSFVRVNLFSDKI-PRKMI 208  Japanese rice
EFC40664   75 ALNNMTTLFNQVHPIYLTFKELLQWTEHAQQTILEM-STNANIDFlqDVNFLTCYDYLQMLVGYVKLILLLNRIkDKELI 153  Naegleria gruberi
EGC34074   74 LTSRAKQHLEELEDHYYTLTDAFDWKEAAFLLLQDIATNTVAINF--TNNIQLCSKFLDLLVLYGKVNYMVSLVtDRKII 151  Dictyostelium pur...
EFA80340   73 LTSRAKQYVEDLEQHYETLVDVCDWKEAAFALLQEIAGNTVALRF--TSSIQLSSAFIELVVIYGKIHILVSMIaDRRVV 150  Heterostelium alb...
A7RU46     76 VQSIQNEVMKGLSNYYFTFVDIMEFKDNASELLTAIDASFVHFDI--TLNFDLTKAYLDLIVTLTALMIMVSRVdDRRSV 153  starlet sea anemone
EJD74871   78 VTLIKQEILKSLSLYYCTFADLLDLKDHILQLLTTMDAAQFKLDI--TTSYDLTAGYMNLVINLVCLMVLLSRVdDRKAV 155  eye worm
P55163     77 VQEKSTEITKSLSLYYYTFADILDLKDHIMQVLTTMESCQCQLDV--TLNYDLTTSYLNLVVHLVTMMILLSRIeDRKAV 154  Caenorhabditis el...
Q5S2C4    143 LHDGAELHLQSLEPWIQLLLDLMAFREQALRLILDLSSTVITLLP--HQNSLILHAFMDLFCAFVRVNLFAEKI-PRKML 219  thale cress
3P8C_B    157 IGLYNYAHEMTHGASDRE-YPRLGQMIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPrRNLSADQWRNAQLLS---- 231 
EGD73771  154 AMVFNATYSMFKGNMEPA-YPRLSQLLLDYDTPARVMYAPFKPHINMILTPLMSVRAHLDtMYQTADEFRKAHLLN---- 228  Salpingoeca rosetta
Q6ZBH9    209 LQVYNILHIMLKGGRDCEfYHRLVQFVDLYDPPVKGLHEDLNFVSPRIGEVLEAVGPIIF-LSTDTKKLRNEGFLSpfhp 287  Japanese rice
EFC40664  154 VCLLNLSYLKLNGQAEPN-IQRVWQLFKDFADPIPRFQEKWFTIQDQIGKALIALIPAFErGTFGGLNVKRP--LE---- 226  Naegleria gruberi
EGC34074  152 TAVYAKLFLYTRSASEPT-YSRMSKWINEFENPIKKIQEEFRAINDSIGQALFSFESTYAkRRVIT-QLRKDGALN---- 225  Dictyostelium pur...
EFA80340  151 LGVYARLVQHLRSQIEPN-YSRVVKWLNECDLPVKKLQDEFRVLNDSIGHVLMSLEPTYAkRKLIT-QLRRDGALN---- 224  Heterostelium alb...
A7RU46    154 LGLFNHAFEMRNGRSEES-FPRLGQMILDYDSPLKKLAEQFVPHQQRVSTALQSLHEIYLrKSMTGEQWRQGQILS---- 228  starlet sea anemone
EJD74871  156 LGLFNAAYELCNGQSEPT-FPRLGQMIIEYDNPWKKLAEDLGPLNRLIHGSLTSLGTVYVrRNITADAWRNAQMLS---- 230  eye worm
P55163    155 LGLFNAAYDLQHGQSEAS-FPRLGQMILDYENPLKKLHEDLGPLNRLIYSALSSVTHTYQrRNKTADSWRTSNVFS---- 229  Caenorhabditis el...
Q5S2C4    220 LQVYNLLHALSRNDRDCDfYHRLVQFIDSYDPPLKGLQEDLNFVSPRIGEVLEAVGPSIF-LSADTRKLRNEGFLSpyhp 298  thale cress
3P8C_B    232 ----LISAPSTMLNPAqsdt-mpcEYLSLDAMEKWIIFGFILCHGIL--NTDaTALN---------------------LW 283 
EGD73771  229 ----IANNPAKMTEPEhmydvlpfT-TSTDRMIHWLVFGYLLIPNAL--AED-ESMM---------------------TM 279  Salpingoeca rosetta
Q6ZBH9    288 rypdILTNSAHPMRAQ--------DLANVTSYREWVLLGYLVCPDEL--LRV-TSID---------------------VA 335  Japanese rice
EFC40664  227 ----MLSEPDRIPFPAvde--tylYLNCYQDIVEWVAIIYACCPDALarAPE-KQIRmtpvvvskkkdkdaplrcyeiLL 299  Naegleria gruberi
EGC34074  226 ----LILKPEDIARPVqdq--yriELAYAGHIYQWILYGYLFAPGCL--TTQ-NSID---------------------LA 275  Dictyostelium pur...
EFA80340  225 ----LILKPEDIARPVqdq--yriDLTYASRMNQWILYGYLFAPGSL--TTP-QSIE---------------------LV 274  Heterostelium alb...
A7RU46    229 ----IINAPANILVPGqskv-pavEYLEVSVIQRWIMFGYTMCHQQL--AMP-GITD---------------------IW 279  starlet sea anemone
EJD74871  231 ----LVASPQQILYAAqtdt-iacEYLSLDVMDRWIILGVLVCHNTLl-NDS-VIAN---------------------LW 282  eye worm
P55163    230 ----LTAAPAQILYAAqtet-iacEYLSLDVIDRWIVFCGTVCHSTLl-NDD-NIRH---------------------MW 281  Caenorhabditis el...
Q5S2C4    299 rfpdILTNSAHPMRAQ--------DLANVTSYREWVLLGYLVCPDEL--LRV-TSID---------------------IA 346  thale cress
3P8C_B    284 KLALQSSSCLSLFRDE-----------------------------VFHIHKAAE--D---LFVNIR----GYNKRI---- 321 
EGD73771  280 LRCLGDGFVLQLYRTE-----------------------------VAYPHTLLD--TtlaSLADAK----KMSKQK---- 320  Salpingoeca rosetta
Q6ZBH9    336 MVVLKENLVLSLFRDE-----------------------------YILLHENYQlyVlpkVLESKRmaksGRTKQKeadl 386  Japanese rice
EFC40664  300 QRVLANNLVIPLYGDE-----------------------------VYNIHDPFKeyVmikKFGDLK-------KEK---- 339  Naegleria gruberi
EGC34074  276 KFVLSEGFYLPVYKEV-----------------------------SISIHNEFN--T---LFKNYKsktiNLQKQK---- 317  Dictyostelium pur...
EFA80340  275 KFALSEGFNLPVFKDI-----------------------------SFPIHNEFN--G---LFKNYKsktiHLQKQK---- 316  Heterostelium alb...
A7RU46    280 KMALQDGFCITLFRDE-----------------------------IFMFHKEFH--N---MLDGMK----GYGKRI---- 317  starlet sea anemone
EJD74871  283 QRALQTGLAIRLFRDE-----------------------------ILIVHQTVQ--S---VFENVK----NYGKKL---- 320  eye worm
P55163    282 QLALQMNLCLRVFRDE-----------------------------TFIVHQEIQ--A---FLESSK----EKSKRL---- 319  Caenorhabditis el...
Q5S2C4    347 LVVLKENLVVTLFRDEvslyqmvcekefgigisfasadsinltmqYILLHEDYQlyVlprVLESKKmaksGRTKQKeadl 426  thale cress
3P8C_B    322 ---------NDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQPGLLGPKALFVFMALSFARDEIIWLLRHADNM 392 
EGD73771  321 ---------AQVAEQLAAAITEAPTLHRDRRTYLRHSLAQLLALVQDKPGLLGPKMPVVLRGLVMARDEVNWLMRHAHAQ 391  Salpingoeca rosetta
Q6ZBH9    387 eynvakqveKMLMEVHEQALVSADALHHERRILLKQEIGRMVLFFTDQPSLLAPNIQMVFSALALAQCEVVWYFQHVGIA 466  Japanese rice
EFC40664  340 ---------KSLKELAEIAAEKCHDYHKELRNYLRLQLKSLLNMMKDQPGLLGPKFNLVLAAISMARNEIMWYFHHNGYV 410  Naegleria gruberi
EGC34074  318 ---------KIVKEAAQASTQEAPRKHAERRVYIRQELEAMWNLFRDKPCLLAPKINVLLAALSMAKEEIFWYFRHTDVT 388  Dictyostelium pur...
EFA80340  317 ---------KVIKEAAQASTQEAPRKHNEKRIYIRQELEAMWNLFRDRPCLLAPKINVLIAALSMAKDEIFWYFRHIDAI 387  Heterostelium alb...
A7RU46    318 ---------KDIQDAANQMAASVG-IHKERRNYLRSALTEMTLILADQPGLLGPKMLIILHGLSIAHDEILWLVRHCCNP 387  starlet sea anemone
EJD74871  321 ---------QEVKDHYSVALQTSLTVHRDRRRFLRGTLRELCLLIRDQVGLLGPKILFVWMALSFSRDEVVWLLRHIDIW 391  eye worm
P55163    320 ---------QDVKDAFNHASVTAVAVHADRRRFLRSSLRELSLLLRDQPGLLGPKILYVWMALGAGRDEVIWLLRHQVEV 390  Caenorhabditis el...
Q5S2C4    427 eysvakqveKMISEVHEQALQLCDTIHRERRILLKQEIGRMVLFFTDQPSLLAPNIQMVFSALALAQSEVLWYFQHAGIA 506  thale cress
3P8C_B    393 PKKs--------ADDFIDKHIAELIFYMEELRAHVRKYGPVMQRYYVQYLS-------------GFDAVVLNELVQnlsv 451 
EGD73771  392 PPKaka---kvnPKVFQDKDLSELLFYITEFNYLLKGQRAIISRYFKDFLT-------------GHNLTVIRETIGalhl 455  Salpingoeca rosetta
Q6ZBH9    467 SSKssrg--rtvDIDAADPTIGFLLDGMGKLCCLVRKYIAAIKGYALSYLSscagrirfllgtpGMVALDLDATLK---- 540  Japanese rice
EFC40664  411 PKSaqk-----kfkEVKETLISEMIYLMDEMMYVCVQHRDVIRKYSLKIIR-------------GLYYNKARQLIEehka 472  Naegleria gruberi
EGC34074  389 PPEkvkk-fynkQNEVRERRIASLLSLISHLVQLVQTHKKMIQNYYVEYIA-------------GADILGLSKVITpqll 454  Dictyostelium pur...
EFA80340  388 PPEkvkk-fynkQNDIRERRISSLFYLIDHLVQLVKTHKKIIQSYYIEYIA-------------GADTLGLSKVLNpqll 453  Heterostelium alb...
A7RU46    388 APRsrk----ltQEDFFDSKLPHLLFAVEELRSMVQKYSSVLQRYFIQYLS-------------GFDVYMLKQVVQkisi 450  starlet sea anemone
EJD74871  392 PVSgnkk--tkhADEVADKQLPELLYYILELRSLVQQHDGVIKRYYSQYVT-------------GYDALILTDIVQsien 456  eye worm
P55163    391 PAIskkg--srmVEELVDRQLPELLFYMLELRDLVTKYYAVIQRYYLQYVS-------------SYDSIVVSEEINqang 455  Caenorhabditis el...
Q5S2C4    507 SSRskaarvipvDIDPNDPTIGFLLDGMDRLCCLVRKYISAARGYALSYLSssagrirylmgtpGIVALDLDPTLK---- 582  thale cress
3P8C_B    452 c--pedesIIMSSFVNTMTSLSVKQVEDG--EVFDFRGMRLDWFRLQAYTSVSKASLGL--ADHRE-------LGKMMNT 518 
EGD73771  456 s---ehehKILNGFAQTLEALASG-------EGASFAGFRLDWLRLQASMCAANVPFPL--HQNEL-------FASYLNL 516  Salpingoeca rosetta
Q6ZBH9    541 --------GLFQQVLHCLENIPKPQGENVpaITCDLTDLRKHWLSILMIVTSSRSSVNIrhLEKATvstgkegLVSEGNA 612  Japanese rice
EFC40664  473 klelakvtGIMESIMSDIQ------------NSEDFEAMRLNWKRVESFLSGYQFKQTL--PEMTL-------LFNTMTK 531  Naegleria gruberi
EGC34074  455 ntagsvvtQQINTILNELKSITPG-------QEYRFDNFRANWMRLGYLLQSNSCPLKE--SEAKQ-------ITSRLNL 518  Dictyostelium pur...
EFA80340  454 qnagttvaQTINTIMNELKSVSLESFNRG--TEYNFNGLRDNWCRLEYLLYSSSCPLRE--AESSQ-------ISSRLNL 522  Heterostelium alb...
A7RU46    451 c--sedisLIMTSFIDELSSLSVKQVESG--ELFHFSGLRLDWLRLQAYTSVRGSSPEL--KDNRD-------LVELMNN 517  starlet sea anemone
EJD74871  457 l--gekesVLLSDFCADLSHINQDSI--------DLRSLRLDWFRFQAYVSMNRSSFTL--NTDRR-------LAVTMNT 517  eye worm
P55163    456 l--tqeeaVLLTDFANEIGNINSDT---------DLRALRLDWFRFQAWTSAARSHFQL--SRHKK-------LAIYMNT 515  Caenorhabditis el...
Q5S2C4    583 --------GLFQRIVQHLESIPKAQGENVsaITCDLSDFRKDWLSILMIVTSSRSSINIrhLEKATvstgkegLLSEGNA 654  thale cress
3P8C_B    519 IIFHTKMVDSLVEMLVETSDLSIFCFYSRAFEK-MFQQCLE--LPSQSRYSIAFPLLCTHFMSCT-HELCPEERHHIGDR 594 
EGD73771  517 AEFNSYLLDNADTFVRETSMPANMWFYRTTLTK-MFDTCVN--SPAHQRFSLAFVMLCDSFSFNA-TPFFPDERMQIGRG 592  Salpingoeca rosetta
Q6ZBH9    613 AYNWSRCVDELEGQLSKHGSLKKLYFYHQHLTT-VFRNTMFg-PEGRPQHCCAWLGAACCFPECA-SSIIPEEVNKIGRD 689  Japanese rice
EFC40664  532 IVVFSKHVDGLYDELVEKGSLKQLYFYRADVDK-IFSEGLIg-SKSQPLYSTAFIRILNTYADNIhPQLNPSLRNRIGQQ 609  Naegleria gruberi
EGC34074  519 IYTHSKNVDCLDQLLDEYGNLTGLWSFKDQLLNgVFDQAIVdmSADQPTHSMIFLKLLSQFPNNA-TQFYPEEKELIGKE 597  Dictyostelium pur...
EFA80340  523 IYIHSRNVDQIEQQLEEFSSLSGLWSFKEPFVA-SFDNTLVe-GNDQPTHVMNYLKLLSLFPSTVpTHFMPEEKEQIGKE 600  Heterostelium alb...
A7RU46    518 VVFHSKLVDLQDETLAEVSDLSIFCFYPGFFEE-SFVRCLE--DITQSRYCIAFPLICGHFMTCT-SDFCPEERHPIGDR 593  starlet sea anemone
EJD74871  518 TVFHLKMIDLIDEMLRETSDLSIYCFYAQQLET-QLHQCLQ--LPSQSRYTVSFAHICSNFRSAL-HDLCPEEKAHIIDR 593  eye worm
P55163    516 SVFHLKMIDLQDEMLRETSDLSLYCFYPKLAEK-HWLNCLQ--LPAQARYVLSFARLAAHFTSAL-HDMCPEEKAFITEK 591  Caenorhabditis el...
Q5S2C4    655 AYNWSRCVDELESQLSKHGSLKKLYFYHQHLTT-VFRNTMFg-PEGRPQHCCAWLSVASSFPECA-SLIIPEEVTKFGRD 731  thale cress
3P8C_B    595 SLSLCNMFLDEMAKQARNLITDICTEQ--CTLSDQLLPKHCAkt-iSQAVNKKSKK--QTGK-KGEPEREKPGVESMRKN 668 
EGD73771  593 AAEMAANFLARIAYNTTLAVHEMAMAH--VALGAELLPSKAVt--vMVARTKKGKA---------------PVSKDADRD 653  Salpingoeca rosetta
Q6ZBH9    690 SISYVESLIESIMGGLEGLINILDSEGgfGSLEMQLSPEQAA----IRLNNATRAK--------AVSGLLAPGHESYPDN 757  Japanese rice
EFC40664  610 SVQFAEQMLGQLVDRIRKGLDLLNSSHgyRMLTHQIGGDVAAqt-iLRRYGKNKQY---------IEEPAVPGVESHFEN 679  Naegleria gruberi
EGC34074  598 CVNFANSYLSKITNRIVSILGNSVAQT--FLSNQHQLDDVNA----AFPLLQKKKD--WKPPkDFV-PPIEPSSESQFRH 668  Dictyostelium pur...
EFA80340  601 CAEIATVFLNKISTRIVNILTTSVATQ--FQSSEAQLADVNA----AFPLLQKRKD--WKPPkDFV-TPVEPGSESSFRA 671  Heterostelium alb...
A7RU46    594 SLSAVNLFLDSMAKEARNIMSQVCSEH--IQQHQQLWHTHAVrm-mTEMASERRTK--DKNKkNVHVEFKPPGIESFRKS 668  starlet sea anemone
EJD74871  594 SLKLCNLVLDELAKETASVTARLCEYE--VRLTEQLSPNNCArl-iEEHDKQKSNK-----IsNTARSLVMPGEESFRYS 665  eye worm
P55163    592 ALAQCNSVIEETCKQLSYILEKVAEHE--FGLAYQMTPSAVAvrvvAQVVQQKGSGkaAAAAaAAARDYFIAGEESYRVD 669  Caenorhabditis el...
Q5S2C4    732 AVLYVESLIESIMGGLEGLINILDSEGgfGALESQLLPEQAA----AYLNNASRISapSVKSpRVVGGFTLPGHESYPEN 807  thale cress
3P8C_B    669 RLVVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRFTKSIVGMTMY---------NQat-----qeIA 734 
EGD73771  654 PETTKKLENLQATLADLCWALNHHVTVNVFNICFSPREYLVKNLSSTVPNALSHLVTM---------NApd-----gvPQ 719  Salpingoeca rosetta
Q6ZBH9    758 SSSVKMLEAAMQRLTSLCSVLNDMEPICVLNHVFILREYMRDCIIGNFRRRFHSMIRT---------DSc--------LQ 820  Japanese rice
EFC40664  680 NS-INDMRDLERNVTQLLYSLSRYDEIVVYDNVFYPVEYLRTVLEEYIAEYIKRIATTidltakemkNDalt----pkFI 754  Naegleria gruberi
EGC34074  669 RANLENLRNEEKNAYQLCNALNEFLEIVIYDHVFIPREFLREKLGNTLKQYMRQSIQP---------PQptssqmdvnIP 739  Dictyostelium pur...
EFA80340  672 RANLEQLRLNEKNAFQLCNALNEFMDITIYDHQFVPREYLRERLGAALKQFMRQTSTPtiat------------dpssII 739  Heterostelium alb...
A7RU46    669 RETLTSLDTKLLSLTELCHAITHTEAIPVWEHIFAPKEYLSSQLEEFFAKAVVSMAQY---------DIdn-----qrIA 734  starlet sea anemone
EJD74871  666 RDTLTLADKLQTALHELCTAVTSSRQVIVSDHIFAPREYLAQQLESQLTQSLQTLISss-----------------ehPM 728  eye worm
P55163    670 RQALTMPDKLQTTLLEISAALGAHRQIYVADHTFAPRTYLAQSLETKFVELLHGMFWE---------GQpha----snPK 736  Caenorhabditis el...
Q5S2C4    808 NKSIKMLEAAIQRLTNLCSILNDMEPICVINHVFVLREYMRECILGNFKRRFLTALQT---------DNd--------LQ 870  thale cress
3P8C_B    735 KPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQT-------------------QHLDS-------HGEPTITSLY 788 
EGD73771  720 RPSVCLSAVKSYMAAYRSLESYVSIDVSSIFANAMLDQT--------------------LVAAg------SEKPTIATSY 773  Salpingoeca rosetta
Q6ZBH9    821 RPSVIESLLRRHLSIIHLAEQHISMDLTEGIREVLLAESftgpfp-------nlqvfeTPTET-------HGGGSAIDII 886  Japanese rice
EFC40664  755 SPSELLSELHSFMSSLKIIEQCVNINTEELVLNSFLDNFvh----------------lNYVDSpfgvvqtTEPANLISIY 818  Naegleria gruberi
EGC34074  740 RLGQYESNLRVFIGVLVFVENYVDIDIGDLIRQTILTEFyakalgksgrvdwfpegeiEMNDL------------TLSTI 807  Dictyostelium pur...
EFA80340  740 RPTAFETQLKVFLGVMVLVENYIDIDVGGLIRETLLAEFyakalgkcgridwfpegeiEYSEV------------TLHNF 807  Heterostelium alb...
A7RU46    735 RPSEVLSNVKAMMSSLRSLENYTGVDTARVFNHVLLQQT-------------------QPQDS-------QGANTITQMY 788  starlet sea anemone
EJD74871  729 RPCQLLASINAHMIVLQNLDTIVTLDVTRLFNSVLLQQT-------------------QYQDY-------HGNDTLTSIY 782  eye worm
P55163    737 RPSEMLLALQAYMTVLQNLDTAISVDISNTMQTTLLQQT-------------------QLVDS-------KNKDTIAALY 790  Caenorhabditis el...
Q5S2C4    871 RPSVLESLIRRHMGIVHLAEQHVSMDLTQGIREILLTEAfsgpvs-------slhtfeKPAEQq------QTTGSAVEVV 937  thale cress
3P8C_B    789 TNWYLETLLRQVSNGHIAYFPAMKAFVnlPTEN-ELTFNAEEYSDISEMRSLSELLGPYGMKFLSESLMWHISSQVAELK 867 
EGD73771  774 VSFYCDLLFKYGGSGAVLFSESRKCLV---SKS-GVNVRAELYTDVTELRALCSLIGPFGVKQLNADLVSRLGHLLKDMK 849  Salpingoeca rosetta
Q6ZBH9    887 SNWYIDNFVKDASRTGVVFDASQNCFR--SSQPiGGGYLAEAFTDKRELKALVRLFGGYGVDRLDKLLREHTSALLNCID 964  Japanese rice
EFC40664  819 SQWFTDLVSDPQKY-KTLFHPNRQTFIstANTP-IQSYNVENYLDYNELKAFITLTGPYGFRALNQSLLDEIYVRSEKIR 896  Naegleria gruberi
EGC34074  808 TNYYVDLVSKKLNVPGVVYSPVKLGFI---SKA-GTPFRAEEHADLSEMRALCDLVGPYGLKVVEREILRFVQTTTASMK 883  Dictyostelium pur...
EFA80340  808 TNYFTDFISKKAQTPGIVYSPGKFGFL---SRA-GLQFRAEEHTDYAEVQSFVNMVGPYGVKLVERELLRYVLQNTQSLK 883  Heterostelium alb...
A7RU46    789 TTWYLDVFLRRVMTDGIVYSPRRMAFV---NRP-GMPFRAEEYTDVNELQALAELLGAYGMRYLGEKMMLQIASQVSELK 864  starlet sea anemone
EJD74871  783 TKWYLEVVLRRMSTGQILFSPHFAALIa-NPDY-QHTFSPDQYTDNRELRALSLLLGPYGVKTMSEKLIWHVASQITELN 860  eye worm
P55163    791 TKWYLEVLLRRASSGHMVWSEHLRTMLs-SGQE-QLSFMPDHYSDPQELRALVQIIGPYGVKLMTERLIWHVASQIMEMS 868  Caenorhabditis el...
Q5S2C4    938 CNWYMDNIIKDVSGAGILFAPRHKYFK--STRP-VGGYFAESVTDLKELQAFVRIFGGYGVDRLDRMMKVHTAALVNCIE 1014 thale cress
3P8C_B    868 KLVVENVDVLTQMRTSFDKPDQM--AALFKRLS-------------SVDSVLKRMTIIGVILSFRSLAQEALRDVLSYHI 932 
EGD73771  850 AIATTNPR-INELAQCIHNASDT--TDVLRSLK-------------DVDLFFKLLSISGLILNFRKLVLEALSSVLEDRI 913  Salpingoeca rosetta
Q6ZBH9    965 SALRSNRDALEGLAGSVNSGDRIerDANLKQII-------------DIETLADFCIQAGQAITFRRLLVEAVGAVLEEKV 1031 Japanese rice
EFC40664  897 EVLSQANNALKDIESKLYDEKFVldKKVRQTLV-------------PLETLMPLLIQLGGILEFRQCLQSALQSSVRRNA 963  Naegleria gruberi
EGC34074  884 EILTLNSANLEEYAANYFKPKAI---EILKRFKv-----------tDFDAIVQKCIAIGNALHLRSMMREAMKDVISENL 949  Dictyostelium pur...
EFA80340  884 EILTANSALLEQYSGCFYKTNGV---EHLKRFKq-----------qDLDNFISRSVGIGNALHLRQMMRQAVQDTNNASI 949  Heterostelium alb...
A7RU46    865 KLVIMNKDVLVALRTNFDKPEQC--IELIRRLR-------------NMDDVMLRMIIIGVILSFRQLIQQALDSVLKTRV 929  starlet sea anemone
EJD74871  861 KIVNDHRDALVLARSCFDKPEKM--RELLLQLSgdikdkkqipvngPMESILQRVTIIGEILSFRSLLHAALHDVLKRRL 938  eye worm
P55163    869 KIVATYKDALQIARSNFDNAEKM--KDVLNLLSvepkdkktpnatcAADAILQRTIIIGQICLFRDALHDALRHIVESKL 946  Caenorhabditis el...
Q5S2C4   1015 TSLRSNRELIEAAAASMHSGDRVerDASVRQIV-------------DLDTVIGFCIEAGQALAFDDLLAEASGAVLEDNA 1081 thale cress
3P8C_B    933 PFLVSSIEDFKDHIPRET-DMKVAMNVYELSSAAGLPCEI-DPALVVALSSQKsenisPEEEYKIACLLMV-FVAVSLPT 1009
EGD73771  914 PFIFTTIQDLHQHVRGSEs-------VNLLALTAGLSSEL-DPTLIRELRPYI-------DDPQHVHMLVL-LFGVTLRH 977  Salpingoeca rosetta
Q6ZBH9   1032 PLIYSLLKGLAMQLPEEVpDKNEIIRLRRVASSVGVGDKH-DAEWVHSILAEI-----GSANDNSWTLLPY-LCAAFMAS 1104 Japanese rice
EFC40664  964 PAIYDVIDSAYEQYSRNYyGDGKFLPIDALATDCGFS-DV-DHPLRLKLSPLV-------DRSQVWEVLPLaFAALTILN 1034 Naegleria gruberi
EGC34074  950 PYIHDSVSNAFKEYNCNTfMFPEFLGVDTLALDTGLDVGIaDQYLKVILRKLS-----TESDKRVWELLPI-MFSLTFFG 1023 Dictyostelium pur...
EFA80340  950 PFIQKSIENAFMEYNRNTfSFPEFLGVDTLALDAGLDVGTaDQYLKVFLRKLSa----TEADIKLWDLLPV-MYAVCFNS 1024 Heterostelium alb...
A7RU46    930 PYMMSCITDMRKNFPHGNnd---rQVVDEMATSAGQECVV-DPLLCAALRTLKek--kSEDDILTWSLLLV-FVAVGLPS 1002 starlet sea anemone
EJD74871  939 PFLLSIVNDLHDTASEHNl-----LMLSELCMAVGINTDV-DVALVHAIRAQTkq-tePDEHYTLSCLLLV-FIALSLPR 1010 eye worm
P55163    947 PFLQASFDMLYHNLDDVDk-----VKIGEMSAAMGVTGPV-DMSLVNAVRAQNpn-ihPQEHYVNSCLLMV-AVAICIPR 1018 Caenorhabditis el...
Q5S2C4   1082 SLIHSMISGIVEHIPEEIpEKKEIRRIKGVANGVGVAGDH-DSEWVRLILEEV-----GGANDNSWSLLPY-FFASFMTS 1154 thale cress
3P8C_B   1010 LASNVm-SQYSPAIEGHCNNIHCLAKAINQIAAALFTIH-KG-------------------------------SIEDRLK 1056
EGD73771  978 IGTSSs-LAFKPAQGTFEGNSQCIATAAAVLSSILMALSsNPsvm--------------------------rqSIVQAQK 1030 Salpingoeca rosetta
Q6ZBH9   1105 NMWST--TAYDVNTGGFSNNLHCLARCVSAVVGGSEYTRmERehrrsslsnghmde---lqepellsrvsaeaNIKSAMQ 1179 Japanese rice
EFC40664 1035 TTWKEkdSVYDVNLEGWYNNTHLSITAFHRLIQAVHSVKsNKi-----------------------------aELEKDYK 1085 Naegleria gruberi
EGC34074 1024 NIWKE--AQYKATIDAHSNNVHVLSKAICDLLIAFGAIN-STsgn--------------------------eaEITSSLS 1074 Dictyostelium pur...
EFA80340 1025 TFWKD--AFYRTAIEGHANNVHVLSITISSLLIGFGSINySSsas--------------------------eaDIVSLLT 1076 Heterostelium alb...
A7RU46   1003 LAYKDa-SEYNGELEAHDNNAHCISSSVNSITGALCSNNgD--------------------------------NPEDRLR 1049 starlet sea anemone
EJD74871 1011 LALTQn-SQYSASLLASKNNLQCIALAVSTIANALFCLHgRN-------------------------------DIIERMK 1058 eye worm
P55163   1019 IGMSDl-SSYKPSIQASLNNSHCVPMAINTIGSALFHLHeQN-------------------------------DIQSRMK 1066 Caenorhabditis el...
Q5S2C4   1155 NAWNT--TGFNIETGGFSNNIHCLARCISAVIAGSEYVRlQReyqqqhqslsnghhssenldsefpprvtaeaSIKSSML 1232 thale cress
3P8C_B   1057 EFLALASSSLLKI-GQETD--K----TTTRnresvYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQ 1122
EGD73771 1031 LIIKIGSVLLLRLq-------K----EGGKnrntaLLVLNKIVEESPFLTADVLEEFLPYSLVRCAQHALCAg 1092 Salpingoeca rosetta
Q6ZBH9   1180 LYVKLSAGLVLDS-WNDTSrpY----IVPK-----LIFLDQLCEMSPYLPRSTLEVHIPYTILRSIYHQLYGA 1242 Japanese rice
EFC40664 1086 RFAEFAAMILLHM-----NgtK----GYEKqydtcCIFLDRTVKTSKHLDISFFEEILPYPLIRTTYVKTFep 1149 Naegleria gruberi
EGC34074 1075 RFLEISSVNILRM-FRGKPneK----FVPNeiqsvIVFLDKFTQQCPLLTKDSLEQFIPYSLIRNMYKDLFEH 1142 Dictyostelium purpureum
EFA80340 1077 RFLEISSVQLLRL-YRQLYq-K----YLPSdpasvIIFLDKFVEECPLLIKDNLEQYLPYTFIRNMFKDIYEN 1143 Heterostelium album PN500
A7RU46   1050 EFLAITSSSLLKL-GMEAE--K----D-LKaresvYLLLDMVVQQSPYLTMDVLESCFPYALLRNAYHEVYQK 1114 starlet sea anemone
EJD74871 1059 EFLALASNGLLRTsEDSND--V----DTTRsrqfvYVILDQLVKLSPFLSFDLLESCFPYNLIRSSYQYCYQl 1125 eye worm
P55163   1067 EFLALASSGILRT-IHERDnsRqisdDVLRshttlYIILEQMVRKNRWLSMDVLETCFPYNLVRTAYQQCYEA 1138 Caenorhabditis elegans
Q5S2C4   1233 LFVKFAASIVLDS-WSEANrsH----LVAK-----LIFLDQLCEISPYLPRSSLESHVPYTILRSIYTQYYSN 1295 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap