5WG6


Conserved Protein Domain Family
VEFS-Box

?
pfam09733: VEFS-Box 
VEFS-Box of polycomb protein
The VEFS-Box (VRN2-EMF2-FIS2-Su(z)12) box is the C-terminal region of these proteins, characterized by an acidic cluster and a tryptophan/methionine-rich sequence, the acidic-W/M domain. Some of these sequences are associated with a zinc-finger domain about 100 residues towards the N-terminus. This protein is one of the polycomb cluster of proteins which control HOX gene transcription as it functions in heterochromatin-mediated repression.
Statistics
?
PSSM-Id: 401612
View PSSM: pfam09733
Aligned: 28 rows
Threshold Bit Score: 137.812
Threshold Setting Gi: 262111239
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5WG6_A       712 DGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFI 791
XP_002613583 403 DLELDWTRPFTSGHNRLYFHSGTCLPLRPQEIDNDSEEESDPIWLKQRTQHMIDEFTDVNEGEKELMKMWNLHIMRNGHI 482 Florida lancelet
Q6DC03       513 DGEQEQQRTYISGHNRLYFHSDSCTPLRPQEMEVDSEDERDPDWLREKTAMQIEEFTDVNEGEKEIMKLWNLLVMKHGFI 592 zebrafish
XP_003965025 520 DGEQEQQRTYISGHNRLYFHSDSCVPLRPQEMDVDSEDERDPDWLKEKTSKQIEEFTDVNEGEKEIMKLWNRHVMKRGFI 599 torafugu
XP_011419619 464 ENDIQINRQFMQGHNRLYYHTLTSEVIRPQEIDVDSEEETDPLWLRQKTVNMIDEFTDVNEGEKELMKLWNLHVMKYNFI 543 Pacific oyster
EFX88992     495 yevcETQRPFITGHNRLYHHTSTCLPIQAKELDVDSENETDPEWLRAKTCMMIDEFTDVNEGEKELMKLWNLHVLKHNYV 574 common water flea
Q16YD4       498 ENEFDSQRPFITGHSRMYHHTMTCLPVHPKELDIDSEGESDPLWLQHKTMQMIDEFTDVNEGEKELMKMWNLHVMKYGYV 577 yellow fever mo...
Q9NJG9       512 EDEISNQRSYITGHNRLYHHTETCLPVHPKELDIDSEGESDPLWLRQKTIQMIDEFSDVNEGEKELMKLWNLHVMRHGFV 591 fruit fly
XP_015793128 458 pdgiiSIRPYIRGHNRQYYQSTDCFPIKPQEIDEDSEAEIDPEWMRIKTQLMIDEFTDVNEGEKEVMKLWNLHGMKHGYV 537 two-spotted spi...
XP_002416184 481 EVDIDLPRPYISGHNRLYYHTETCLPIRPQEIDRDSESEDDPDWLRIKTQLMIDEFTDVNEGEKELMKMWNLHIMKHGFV 560 black-legged tick
5WG6_A       792 ADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVT 843
XP_002613583 483 ADCQVPTACSTFVEEKGVWIVQRNLVRNMLLHLVNLYDFSLISSSVVQQTIS 534 Florida lancelet
Q6DC03       593 ADNQMNQACMSFVEQHGTIMVEKNLCRNALLHLINMHDFGLITTATIDKAMT 644 zebrafish
XP_003965025 600 ADNQMNEACLLFAEHHGAHIVHNNLCRNFLLHLISMHDFNLINTLTIDRAMA 651 torafugu
XP_011419619 544 ADCQIPEACYTFVNEHGEAMVKKNLAKNFLIHMVNLFDFSLIRPDVVHKTMR 595 Pacific oyster
EFX88992     575 GDCQMGVALQMFLDNHGQELLKRNLYRNFILHLSNLYDFGIIAPATVLRTIn 626 common water flea
Q16YD4       578 GDCQIPVALDMFIDCRGRDLLRKNLYRNFILHVCSMFDFGLVSPEVMQNAIR 629 yellow fever mosquito
Q9NJG9       592 GDCQLPIACEMFLDAKGTEIVRKNLYRNFILHMCSLFDYGLIAAETVYKTVQ 643 fruit fly
XP_015793128 538 GDCQIPAACEKFVDQYWQEIFNRGLYKNFILHLNNLFDFGILPATHMRSVIK 589 two-spotted spider mite
XP_002416184 561 GDCQIALACNLFVEQQGEVLMQRNLYRNFVLHMCNLLDFGLVSTSVVYTTVR 612 black-legged tick
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap