Conserved Protein Domain Family
Mitofilin

?
pfam09731: Mitofilin 
Mitochondrial inner membrane protein
Mitofilin controls mitochondrial cristae morphology. Mitofilin is enriched in the narrow space between the inner boundary and the outer membranes, where it forms a homotypic interaction and assembles into a large multimeric protein complex. The first 78 amino acids contain a typical amino-terminal-cleavable mitochondrial presequence rich in positive-charged and hydroxylated residues and a membrane anchor domain. In addition, it has three centrally located coiled coil domains.
Statistics
?
PSSM-Id: 370640
View PSSM: pfam09731
Aligned: 18 rows
Threshold Bit Score: 347.084
Threshold Setting Gi: 74858195
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6PFS4        39 GSSAGKivaasLLTVGGGLGGTILYAKWDPKFRSSIEKS-VPYSDQLFDMVLGAPPSPPVpi----------qkKPETVK 107 zebrafish
Q9ASV5        69 KGNSSK-----VVIGGVAIAGAFLVAYQTGYLDQYLGKEqQKLSERIHSDALTEKLEEAHhlnvpsgvedstekDGKVET 143 thale cress
P91928        68 EAGFGKvv--lFVSPLAAVGGVITYAKYDDDFRKLVEKN-VPGAGSVIKVALQEEPPFKGitknvndqidkvksGIETVT 144 fruit fly
Q16U68        37 EAGFGKvl--vvLSPFLVGGGVVAYAKYDNEFRKTLVTN-VPALEPVLKALLQEENPLDEvs-----------kKLDEIS 102 yellow fever mo...
DAA24582      40 rlSASKiagagILFVGGGIGGTILYAKWDSHFRKNVEKT-IPYSDKLFEMVLGSPPYTVPlp-----------kKPIQSG 107 cattle
NP_001006462  41 gVSVGKiigasVLFVGGGVGGTVLYASYDPRFRENVEKA-IPYSDKLFEMALGPAPYSVPip-----------kKPVQQG 108 chicken
Q9XXN2        20 SSGGLKfvgatVGAVTAGAAGVAGYASYDNEFRKKLEGV-IPGSRTILNYTIGEEEPPAP--------------RLKDLR 84  Caenorhabditis ...
Q22505        37 KSGGGKgl-alVGATVVGAGGVVGYAYVDPEFRHKVEST-VPPVKQVFDAVLGES-SLQK--------------TKQQIG 99  Caenorhabditis ...
Q5K8K8        77 PRRFRRvfvytALGVAGFYALSGYVGTKSDAYRDLFTQY-VPGGEAVADYADDNDWD--------------------NVS 135 Cryptococcus ne...
KIS72220      40 RSGLGRlfvysTVGATVFYGISTVAALNNDRYNHFFVES-IPGGERIIDYLDTHDVGQEIksinlhgygdkaidVTKTAY 118 Ustilago maydis...
Q6PFS4       108 PLQISSLSEATKDSKQPKAKAKKSDpapppsveeapapapalqsleeasaeaAHI-ISAISEVPSVPAPGTSDESPSGhs 186 zebrafish
Q9ASV5       144 QPQVTHSEASEGVQSDIELQPESDLs-------------------------sDRF-TYISSNQEETPQETVIDRAEIN-- 195 thale cress
P91928       145 STVDSVTSKVTGLFGGGSGDDKSKKskvepv---------------katpaeEKR-PSKPSEVSKTEAKPVSKPAAAAap 208 fruit fly
Q16U68       103 STISGYTSTVTGFFTGVSKEEEKKPektkp-----------------skpvaK---PAAPAAPSPAPASKAAPAKATApa 162 yellow fever mo...
DAA24582     108 PLKISSVSEVMKESKQPASQPQKQKgdtsasttagdt---lsvpapvvqheeLIK-TDHPETGEGKPKPATSEEASSTsv 183 cattle
NP_001006462 109 PLKISSVAEVMKESKQPVPKPQ----------------------------------TSKTEAVAPSEEKEDKEHEGSHai 154 chicken
Q9XXN2        85 PLQYSADPKVPPKPFEPKPVKKELIg--------------------------VKEnLKETTEPKKIEKKPENPYIGAK-- 136 Caenorhabditis ...
Q22505       100 DLKDAVVNAVPKKKEVLPPLELAPLppv----------------------lpR---EPTHVDPVDVRKDVTPMIPKPS-- 152 Caenorhabditis ...
Q5K8K8       136 GKAVRAWQSITGARPETRTEKVERKi------------------------------GEVRQEAAKVPAQVKDKADEAKdh 185 Cryptococcus ne...
KIS72220     119 DSVSGAVSRVFSGDAGASESAGDERd---------------------------AR-LRVSEARATAKAEADKLAQRAKv- 169 Ustilago maydis...
Q6PFS4       187 aaaeecckectepepavkerpaeevtarlaqQDKAELDALAALTAGLEETLGSSAKVTLQAIGAQEAALTAIAAHTDKLR 266 zebrafish
Q9ASV5       196 -------------------------------LPISASEDSGAKPDMPSEIISEAESVKLEAVPKPGDSPIIVNAQSSSVH 244 thale cress
P91928       209 apaa---------------------kpkdnpLPRDVVELEKAIELSAQLAVKEYNVAIGVLKGFNDDVRKVVDKAVENGE 267 fruit fly
Q16U68       163 aaatvpk---------------piapkpaeeVPKSISDLERQIDVAAATAIKEYGKAVQVLKDYTNEVKKVVDESVDKLD 227 yellow fever mo...
DAA24582     184 rerppe-----------------evaarlaqQEKQEQVKIESLAKSLEDALSQTARITQQAIVAQNAAVQAVTAHANILK 246 cattle
NP_001006462 155 kerspd-----------------evaarlaqQDKEEQEKISALAATLEGALSSTARITLQAITAQESAVQAVNAHLQILK 217 chicken
Q9XXN2       137 -------------------------------TPLNPQERNEKLTESLKNHLTQAEKATKVATSAKLETIRAIEHHVQTIR 185 Caenorhabditis ...
Q22505       153 --------------------------------PDVVFAKNQQLEEKLKIAIHSAEGKVRLATEAKLKTINAINEHASILK 200 Caenorhabditis ...
Q5K8K8       186 v----------------------------vgKHTASQKIHERAEELRKAVEQKTHEAEARLKELTGEAKHKVQEATKDAP 237 Cryptococcus ne...
KIS72220     170 ------------------------------aAEKAEHQAESALQAVQDKTSELVNRAKAAAERAEAKVRGQTTEASKDGR 219 Ustilago maydis...
Q6PFS4       267 EAMDSETPpdekstqalnealneraravddagea--------lfkakgeleklrsvidkakqskidsaRPQILAAEEN-- 336 zebrafish
Q9ASV5       245 RESETESA------------------------------------------------------------SPKDPAALKT-- 262 thale cress
P91928       268 NSLWTTLKnrasardtavataeraar-------------------------eaqekivaceialsaaaTAQNAKKVEAvr 322 fruit fly
Q16U68       228 SSSWVLLRnrtsardtalkaaedaaeda---------------------renieklhrlldsrdikcsDELKDKAREN-- 284 yellow fever mo...
DAA24582     247 AAMDDSEIagdkksaqwrtvegalkerrkavdeaad-----allkakeelekmksvienakkeevagaKSHITAAEGK-- 319 cattle
NP_001006462 218 EAMDDSETagekksaqwrtleealkdrrravdeaad-----vllkakeelektkgvienakksqipgaKSHIIAAEEN-- 290 chicken
Q9XXN2       186 EAIEAGKDgdwdsvtvahlkakrlaekdekaek-----------larnavadlvteanlggqgettqlNPLVPISKAT-- 252 Caenorhabditis ...
Q22505       201 QTVDDAKHanwenvtsalqraeaearvdsgqev-----------dgrnyidnlrkivndgkrdsttatNPLLLNAQET-- 267 Caenorhabditis ...
Q5K8K8       238 FNFSEGVEgivraaesalhktehkaaeaadkvkpaearpsspfpdtqrprelkpetvtpqvpsyegkkLYTGPPLPLGhe 317 Cryptococcus ne...
KIS72220     220 NIIQRAVDsvqvmtdigantkaapsksaapg---------------ngpkeevketyigelpvnheapVGYAAPRRDR-- 282 Ustilago maydis...
Q6PFS4       337 --------LHSMIVDLDKVVTKVQTAQSEAKIVSQYSELVNEAKAQfqqelaNITPEIQANWKGLSGkLSADDLNSLIAH 408 zebrafish
Q9ASV5       263 --------PEDGIEREVQLPGSLLKEYNLEGSDTESTGSSSIGEQI------TKETEAFPNSTEGLKdSYMTEDGKLVLD 328 thale cress
P91928       323 ------dkIKKLVDHIGNVKDELYRHKDTASVSDKYWRNVEKARNYfideieSIFPGLSLADKKLNL--SKEDLDLFILH 394 fruit fly
Q16U68       285 --------IASYLEHLKKAKEDVYKARNLATLGEKYWKKVETARNFfideieSLFPGI--NLSEKKLdLSKDDLDLFILH 354 yellow fever mo...
DAA24582     320 --------LHNMIIDLDNVVQKVQAAQSEAKVVSQYHELVVQAREDfkreldSITPEVLPGWKGMTDkLSADDLNALIAH 391 cattle
NP_001006462 291 --------LHHMIVDLDNVVKKVQAAQSEAKIVAQYHELVATAREEfqreldSITPDVQPGWKGLTGqLSTDDLNSLIAH 362 chicken
Q9XXN2       253 --------AEKLSNELDEMISNVKHVDSERIFVHDYSDRVAESRRKfqmelkAVHPNLN---YEDGMkIKKADLHTILAH 321 Caenorhabditis ...
Q22505       268 --------ANKLSHQLDEINALVNKSRQESAVLNQYKDLIEKSRQQfalemkSILPNVDIHAKDKNL--NEDELNALIAH 337 Caenorhabditis ...
Q5K8K8       318 pppgyylpPPPSTKKEKVEEKVEEIKERLPLLVPKVKEFASEEPIIsq--laSTIDSLTSSLSTPSK-ALSSDATGILNK 394 Cryptococcus ne...
KIS72220     283 --------GLQAPDHPTARLRPDPEAPKLPLLAPSIKSLSASEPMIaq--laGTIDELTVFLKETPS--SGAKAKGVLES 350 Ustilago maydis...
Q6PFS4       409 AHRRIDQLNRELAEQRVREQIHIEVALEQQKLEdQKAQERAVISALEHSRE------DMRLEQEKKVQEVREVMEAEMRT 482 zebrafish
Q9ASV5       329 FLAAIHAAEKQQAHLDAQVFAEELRALKEKYENeLRDLRARELMRIEEAAIldkelkRERTKAAAAIKAIQERMEDKLKA 408 thale cress
P91928       395 AYTHVLAYQKELQRLQTDGELRLKRAIDSVR---GDNDSEALRAQLEYHLEae--rrKLAVENQKKIFHIHAESDKLLRL 469 fruit fly
Q16U68       355 AFTQVVAHQKELQKLQIEGDQQLKRALEAVR---GTDQSEAVKAQLEYEIAke--krELNLRNQRKLLAIRAELERNLRS 429 yellow fever mo...
DAA24582     392 AHRRIDQLNRALAEQKATEKQHIALALEKQKLEeKRAFDSAVAKALEHHRS------EIQAEQDRKVEEVRDAMENEMRT 465 cattle
NP_001006462 363 AHRRIDQLNKELAEQRVREQQHIELALEKQKLEdKKALEAAVAKALEHHKS------EIEIEQEKKVEEVREVMESEMRT 436 chicken
Q9XXN2       322 AHLRIDQLSQKLIDSKLNEEKRIQSIIAKKKEDlLEKLRLETNAKQAAVIPefd-kkKLDAELARATAEIQKKYDEKLK- 399 Caenorhabditis ...
Q22505       338 AHLKVDQLRCQLSDQQVREELHISKALEEQRLAdERIASEKLSIEMSrv------grQNELEIERALVESRSSWEGELEN 411 Caenorhabditis ...
Q5K8K8       395 AQDDLTALNARLQEVKKAEKAKLEQSISEKKKE-----FEALLKSMEAEKAks--eeGLKQTWQHERQTMVEDWRKELEG 467 Cryptococcus ne...
KIS72220     351 AQIDLEQLSQRLETIKRQEAKRVEDSLAAQAKR-YETQISKQSQEAADKLSsr--esDWQKSFEEEHAKQTQQFKEKLEK 427 Ustilago maydis...
Q6PFS4       483 QLRRQAAAHTDHLRDVLKVQEQELreeaqeilNSKMMEQEthyrrltqeqlDTFTLDMNAAYARLKGIEEAIDS------ 556 zebrafish
Q9ASV5       409 ELEQKETEAQLALSKAEELAKAEM--------ISTIAKEK-----------AAQIEKMAEADLNIKALSMAFYA------ 463 thale cress
P91928       470 QLKKQAEAHADHIKDIVAQRETDLtrsfkrelEDKLATEK-----------ANYKLQLAGMLGKLRGMDAALAE------ 532 fruit fly
Q16U68       430 QMKRQSEAHTDHLADALAQKEVEMkrkfqrelDEKITTEQ-----------AAYKLQLAAMLGKLKGMDAALKEiddemk 498 yellow fever mo...
DAA24582     466 QLRRQAAAHTDHLRDVLRVQEQELkyefeqdlSEKLAEQElqfrrlsqeqvDNFTLDINTAYARLRGIEQAVQS------ 539 cattle
NP_001006462 437 QLRRQAAAHTDHLRDVLKIQEQELkvefeqnlSEKLSEQEmqfrrltqeqlDNFTLDINTAYARLKGIEQAVES------ 510 chicken
Q9XXN2       400 --------------EVVRTQKQLYdiehakdvDEAVLKER-----------NLHSSAVGKALAQLAGIEKALSG------ 448 Caenorhabditis ...
Q22505       412 QLKRTASAHSEHLEQVIRTQRQLFeieqnqkvEEAVLQER-----------NLHSKQVGAALSRLEGIEEALGS------ 474 Caenorhabditis ...
Q5K8K8       468 ELEQQRQSIEQRLREEVVSQGIELqrrwlrsiKTQVETER-----------GGRLAKLDSLTTSLKQLERITLD------ 530 Cryptococcus ne...
KIS72220     428 ELATQSQIINERLKEEVIAQGIELqrrwmkdiKAKVEEER-----------GGRLSKLDELATDLKSLEKVSLD------ 490 Ustilago maydis...
Q6PFS4       557 -HVIAEEEARKAHQLWLSVEALNYTLKSAgad-----sptEPLEGAVRAIKES-----CAENEFAQALAIAIPEESLNR- 624 zebrafish
Q9ASV5       464 -RSEEARQSHSVHKLALGALALDDTLSKG-----------LPVQKEIDTLQTYle--gTHKDSILGLVLSSLPEEARSN- 528 thale cress
P91928       533 -RADAERTANQAQALWAACQALWASVRAAtpgvh-ykdrlRPLKNEINAIAKV-----AKGDDLVAAVLESVPKEAQER- 604 fruit fly
Q16U68       499 gRADAEKSAHQAQALWGACQSLWSSIRSGqpgks-wreqlRPLKDEIGAVARA-----AEGDELVGVVLKGLPETAKNR- 571 yellow fever mo...
DAA24582     540 -HAVAEEEARKVHQLWLSVEALRYRMKTAsad-----lptVPLGSAVEAIRAS-----CSDSEFAQALTAALPPESLTR- 607 cattle
NP_001006462 511 -HAVAEEEARKAHQLWLSVEALKYCMKTAsgd-----sptEPLESAVKAIKAS-----CSDNAFTEALTAALPQESLTR- 578 chicken
Q9XXN2       449 -HLQMDIENRKSKQMWLATQNLKGTVIFGnrasccmegrrAPLGDQMKTLLSCcg--gGNSDEFVKTINTAMSKTSKVR- 524 Caenorhabditis ...
Q22505       475 -RVALDNENRRAKQFWIACHNLIDTLKHGnkagnniderrLPLNESLNLLKEV-----NPEDEFVNAIIDSFPKQATTV- 547 Caenorhabditis ...
Q5K8K8       531 -NSATLDDNVRLHKIWSALRAVQSKVDSGd----------LAFDDELRALKSLstptaSSGEGVVRSALEQIEKSGIPQt 599 Cryptococcus ne...
KIS72220     491 -NSSVLDENLSVHTLWTAVRAVQHALDDAsa-------tkRPFAEQLRVLKGTs---kARDDPVLSAAIEALDASGAADt 559 Ustilago maydis...
Q6PFS4       625 GIYSEASLRARF-YDIRRLARRVALI-DETRNSLYQYFLSYLQSVLLFERDQeapp-----aklaPEDLDTFKLLAYATY 697 zebrafish
Q9ASV5       529 GTDTVLQLNQKF-DTLKGTLRHFSLI-PPGGGGILAHSLAHVASSLKFKEVD-------------QANGGIESVIKKVDN 593 thale cress
P91928       605 GVYPEDALRERF-LNVERVARRLALV-PEEGAGLPIYFLSYLQSLFILRPDNpiskdelenkpfdYSKLDTYDILNRARY 682 fruit fly
Q16U68       572 GVYPEDALRERF-IKVEQVSRRLALV-PAEGARLPLYFLSFLQAALIAKPDVpiskdeledkpfdFNKLDTYDILNRARY 649 yellow fever mo...
DAA24582     608 GVYSEETLRVRF-YAVQKLARRVAMI-DETRNSLYQYFLSYLQSLLLFPPQQlkpp-----aelcPEDADTFTLLSYASY 680 cattle
NP_001006462 579 GVYSEEALRARF-YTVQKLAKRVAMI-DETRNSLYQYFLSYLQSLLVFHPQQlkpp-----aelsPDDLDTFKLLSYASY 651 chicken
Q9XXN2       525 GEYTEQDLNTRF-NKVCRIGRRVAYV---NEGGALAHLYSWLKSSLTIELVPkkgan----esltPAVENNFTLLTRAEQ 596 Caenorhabditis ...
Q22505       548 GTYTEQDLKNRF-EQLYKIGRKTASI-DENGGTLGAYFWSYVKSLFLVDMPQqygnl----daidVNNTDNYEILSRAKQ 621 Caenorhabditis ...
Q5K8K8       600 GVKSFAALSSWFtNTVAPRIQSSSLVpAPEEATVISHLASAGLSKIMFRPQAgr-----------vPGDSVGAVLARAEW 668 Cryptococcus ne...
KIS72220     560 GVETFTTLKQWFdDKVGPRVRQVSLVpSPETSGVLSHLASAALSPILFH-KKgl-----------vPGQDVPSVLARAEY 627 Ustilago maydis...
Q6PFS4       698 SIERGDLELAAKFVNQ-LRG-ESQRVAQDWLKEARLTLETKQVISLLSAYAN 747 zebrafish
Q9ASV5       594 YLAEGKLAEAAATLEEgVKGsKAEEIVSDWVRRARNRAITEQALTLLQSYAT 645 thale cress
P91928       683 HVDRSDFLQALKYMNL-LQG-ASRKIAGEWMKEARLMLETQQAANTLMAHAA 732 fruit fly
Q16U68       650 WLDRGDLVKTVQYMNL-LQG-ASRKAAMDWLNEARLLLETQQAASTLMAHAS 699 yellow fever mosquito
DAA24582     681 CLEHGDLELAAKFVNQ-LKG-ESRRAAQGWLKEARVTLETRQIVEILTAYAS 730 cattle
NP_001006462 652 CIEHGDLELAAKFVNQ-LRG-ESRRVAHDWLTEARMTLETKQIVDILTAYAS 701 chicken
Q9XXN2       597 LWKSGKKSDAIRVLQL-TDG-ATRRVAADFIADARRQHEALLLSRLLLAHAA 646 Caenorhabditis elegans
Q22505       622 YVHNGDLDKAIRVVQL-LKG-QPAHLARDWIVDTRSYLESRLLAQLLVAHAA 671 Caenorhabditis elegans
Q5K8K8       669 CLAEKDLDGAAREINS-LTG-WPAKLANDWLQQARRKLEVQQALEVVATEAT 718 Cryptococcus neoformans
KIS72220     628 YLDRKDLDSATRELNQ-LKG-WPKLLASDWLAASRKRLEVQQALDVVQTEAS 677 Ustilago maydis 521
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap