4QTJ


Conserved Protein Domain Family
Gti1_Pac2

?
pfam09729: Gti1_Pac2 
Click on image for an interactive view with Cn3D
Gti1/Pac2 family
In S. pombe the gti1 protein promotes the onset of gluconate uptake upon glucose starvation. In S. pombe the Pac2 protein controls the onset of sexual development, by inhibiting the expression of ste11, in a pathway that is independent of the cAMP cascade.
Statistics
?
PSSM-Id: 401610
View PSSM: pfam09729
Aligned: 93 rows
Threshold Bit Score: 111.077
Threshold Setting Gi: 402466380
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4QTJ_A                 5 TyngYIHNTRDALAVIQQV--LDKQLEPVSRRPHERERGvLIVSGSVFVFIEQSS-------GIKRWTDGISWSPSRIQG 75   Candid...
WGS:AFBI:EDEG_03638 1621 nfnvYINTQEEAILIAHAF--RLNLFHLSTERLDQKNRE-KIRNGDVFCFIENEQ--------LRRWTDGKIWSPSKIVG 1689 Edhaza...
XP_006678243         105 sffgFVSTPLDAAILIHAAcsQSDIVTPIKRRLLSVERD-LIRSGSIFVFTESDS-------GMKRWTDGMRWSKSRVEG 176  Batrac...
CCA68845              33 hprlHVRDVRDALIILEAV--RLGILKQVTRRLNDAERSmYVRSGSVFVWEESEDd-----aGIKRWTDGCMWSQSRMRE 105  Serend...
CEL63207               8 ctnvHIRTTADAHRIFHAT--LLGIYPSITRRLDIEERR-LVKPGACFVWEERGPdaeatgmGIERWTDGLRWGPSRVRD 84   Rhizoc...
Q6CCL8                 5 TyhgHVKSAMDAIILFEAC--RLGTLPRVQRRLTEKERL-SIRSGSVFVWDEREA-------GMRRWTDGKSWSASRVSG 74   Yarrow...
XP_002174105           3 TytgLVKTPLDAIILFEAC--RLGILPRVQRRLSDHERN-NIQPGSVFVWDEREA-------GMRRWTDGKSWSASRVSG 72   Schizo...
EPY53314               3 TytgVIKTPLDAIILFEAC--RIGLLPRVQRRLSDHERS-LIRAGSVFVWDEREA-------GMRRWTDGKSWSASRVSG 72   Schizo...
Q10294                 3 TytgIIKTPLDAIILFEAC--RIGLLPRVQRRLSDHERS-LIRAGSVFVWDEREA-------GMRRWTDGKSWSASRVSG 72   Schizo...
WGS:AFBI:EDEG_02593    8 T---CLHTELDVIMLIDLC--RYNILPRVTRRLTYNEKK-LIKDGSVFVYEETES-------KMKRWTDGRLWSPSRSCG 74   Edhaza...
4QTJ_A                76 RFLVYGEL-----------DKKNLIDKdkkkkkkrkfgpddeydhnvnepdytggygnhlhndnrshlnknsrsgpmll- 143  Candid...
WGS:AFBI:EDEG_03638 1690 YFLQYKEV-----------PRHLSKNAikkkksycenynyskdiknrksnlfydykinrnitnknpaqlirskdnvfakn 1758 Edhaza...
XP_006678243         177 QFLVYRRV-----------DPKRPSSGfvastgavtpsgpkpassldsapasgyttpngtnttsvtvqprtafwldavda 245  Batrac...
CCA68845             106 PFLFYEEKvqddr-tgnatSKNRSQSIgessssslspltpalsptrggpsshs--------------------------- 157  Serend...
CEL63207              85 DFLFYHQRdtea----ddeDRNEGGDGgrappakwlkkfarrrkadsphhhhhh-------------------------- 134  Rhizoc...
Q6CCL8                75 SFLTYREM-----------EGRREGGEvyhvsagpvenansgsvestgdsa----------------------------- 114  Yarrow...
XP_002174105          73 SFLTYREM-----------EGKRKSSRnhhssrstspqqkrqggsgaded------------------------------ 111  Schizo...
EPY53314              73 SFLTYREM-----------EGKRKPYQgtpgdstvkrsssvephnhsslssfh--------------------------- 114  Schizo...
Q10294                73 SFLTYREM-----------EGKRKPYHhglstdgslkrspsadttgnsslnay--------------------------- 114  Schizo...
WGS:AFBI:EDEG_02593   75 IFLGYREYkpmvnlyndsgSSWSYSYQsniskdsqcastyhaldnseksfiqtndkdgnlfdinidgnlffpnsgsnfll 154  Edhaza...
4QTJ_A                   --------------------------------------------------------------------------------      Candid...
WGS:AFBI:EDEG_03638 1759 qnqkiffdeendvdenfgktklknfydrkyqnydldiideknnnfrrntdif---------------------------- 1810 Edhaza...
XP_006678243         246 snsqlcvdqnmpcsassmdnedhvhdyitvasnsnaatvtgshvgeplsstalassnaacla------------------ 307  Batrac...
CCA68845                 --------------------------------------------------------------------------------      Serend...
CEL63207                 --------------------------------------------------------------------------------      Rhizoc...
Q6CCL8                   --------------------------------------------------------------------------------      Yarrow...
XP_002174105             --------------------------------------------------------------------------------      Schizo...
EPY53314                 --------------------------------------------------------------------------------      Schizo...
Q10294                   --------------------------------------------------------------------------------      Schizo...
WGS:AFBI:EDEG_02593  155 kencglntdfstiskyniparkssisddincnnnnllngvkfrkysvdnmknnrrinsckelgnfnkkmikelgnkkfkc 234  Edhaza...
4QTJ_A               144 ---------------------------------------------------------------------------atgtg 148  Candid...
WGS:AFBI:EDEG_03638 1811 -----------------------sgskfienvvddeknkfstyidrssgrksntddvedyfekdpksgiytledinseci 1867 Edhaza...
XP_006678243         308 ------------wapdsqqfyalgkrshsptrssvhhlplptrpssamsynsapasspaatddydkgaiedveysgfmas 375  Batrac...
CCA68845                 --------------------------------------------------------------------------------      Serend...
CEL63207                 --------------------------------------------------------------------------------      Rhizoc...
Q6CCL8                   --------------------------------------------------------------------------------      Yarrow...
XP_002174105             --------------------------------------------------------------------------------      Schizo...
EPY53314                 --------------------------------------------------------------------------------      Schizo...
Q10294                   --------------------------------------------------------------------------------      Schizo...
WGS:AFBI:EDEG_02593  235 nfnsenredifknnlrrkseiicgenerynaeiekrkfsvetrignnnfnennnlsrfndikhdnlldsffindknskpe 314  Edhaza...
4QTJ_A               149 sithtvienkpsssasmihsnvipasssfltdyrtslgngpmvsaaiSQNG--LVKKTIT--LT-TTTKElhmegkaekq 223  Candid...
WGS:AFBI:EDEG_03638 1868 drdgkkyrnnatpepigflekfnqnnnyrspfkklqnngnyakfvdnNNGKftLYKKTIS--LT-LNNKV---------- 1934 Edhaza...
XP_006678243         376 npvmkrqrtlensmptrlhsapimrrqtstestisttsfgsaggspyTDDT--LSKKTFS--VK-IRGVV---------- 440  Batrac...
CCA68845             158 ---------------------hqsspshhgsvpqaysnavhspfgdgATGGpgLVKQAYSayVT-APGTSir-------k 208  Serend...
CEL63207             135 --------------------hhhssspvsprsprlaapgaidrtadrENDR--LIKQTYSvfAT-IPGSGrqq------r 185  Rhizoc...
Q6CCL8               115 -----------------------nspssrdpspdsiqlittpegyryKPDG--LMKQSFS--ITtSTDLR---------- 157  Yarrow...
XP_002174105         112 ------------------------sngtqtddsaddedvssssglhyKPNG--LVKQSFS--ITtSFNQK---------- 153  Schizo...
EPY53314             115 ----------------------qddsgagsmsddssmddenmrglhyKPNG--LIKQSFS--ITtSLNHK---------- 158  Schizo...
Q10294               115 ---------------------snedsgaaslsdeesvddenlrglhyKPNG--LIKQSFS--ITtSLNHK---------- 159  Schizo...
WGS:AFBI:EDEG_02593  315 ylanenacnamqltdnngdnsnsytfdssktkssdsnfnklgsfcqmNDENkyLYKKTLT--AT-LKNRT---------- 381  Edhaza...
4QTJ_A               224 tIHLISYY 231  Candida albicans SC5314
WGS:AFBI:EDEG_03638 1935 -YHLIAYF 1941 Edhazardia aedis USNM 41457
XP_006678243         441 -SHVICYF 447  Batrachochytrium dendrobatidis JAM81
CCA68845             209 kFHLTAYF 216  Serendipita indica DSM 11827
CEL63207             186 kWHITAYF 193  Rhizoctonia solani AG-1 IB
Q6CCL8               158 -LHLISYF 164  Yarrowia lipolytica
XP_002174105         154 -LHLISYA 160  Schizosaccharomyces japonicus yFS275
EPY53314             159 -LHLISYS 165  Schizosaccharomyces cryophilus OY26
Q10294               160 -LHLISYS 166  Schizosaccharomyces pombe 972h-
WGS:AFBI:EDEG_02593  382 -YHIIAYQ 388  Edhazardia aedis USNM 41457
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap