Conserved Protein Domain Family
Taxilin

?
pfam09728: Taxilin 
Myosin-like coiled-coil protein
Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed. It is a novel binding partner of several syntaxin family members and is possibly involved in Ca2+-dependent exocytosis in neuroendocrine cells. Gamma-taxilin, described as leucine zipper protein Factor Inhibiting ATF4-mediated Transcription (FIAT), localizes to the nucleus in osteoblasts and dimerizes with ATF4 to form inactive dimers, thus inhibiting ATF4-mediated transcription.
Statistics
?
PSSM-Id: 401609
View PSSM: pfam09728
Aligned: 54 rows
Threshold Bit Score: 132.756
Threshold Setting Gi: 124457818
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A0D4Z8                         32 KIARQSKI-SKSQLDSLEDK-TaliTRLKKIINESKTAHKDALLSAKKFEIATQEKEKVFNENSKLKNQIKTLEGF---R 106 Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00047689A  49 KAYTDLKE-FISANPDDANKiQ---EKFEKILKDIKQAAKDYAINKKLYETLIANFKKTKDENAQCIKSKDNYEKL---H 121 Tetrahymena thermophila SB210...
EFA75417                       87 KSMKDLSS-SLATLKE-DEKvKlllSKYQQNLTERFKYDKKLAQNEEAMSVLNKDNGRLAAELTKSNVVKVRLETL---F 161 Heterostelium album PN500...
EDQ92893                       55 EEERDAVD-QLLAKAAPDERyEtlrNLYVSLKISYNRVLPQIQRMQTKFQQLISQRDKATEELERANTARRTLEEL---C 130 Monosiga brevicollis MX1...
EFA04014                       52 KSWDNISK-VITGMDE-DSKvAyigEKYKDLHEQVRSLTASNQQYVKYNAAIQKERDHHQSELAKSVVARARLENL---C 126 red flour beetle...
A0D273                         24 KAEESYKE-LIKNLNE-DLSiEqlkQLGNQFLEFSLVLQQDEYIQRKRAKEETQEKEQLL--HKEYPQLQDKLIKLkqnC 99  Paramecium tetraurelia...
Q8RXD7                         93 PISQTLSE-GSTQNSTLSKEmDslkPKKQEVVESKRKGSKNMFKSEKEFLEFMLKYQQVLSERDSAITVRDKLESL---C 168 thale cress...
Q84VE3                        122 KESS-----VVEQVESMADQkVviaEGSGE--QKRKVVKKSKVEKDRELFELAQAYHKVVAERDAAIAVKEKLESL---C 191 Japanese rice...
XP_004994135                   35 KEFRQIMQsPATGLND---ReKaavQRYTALKQENGSLKKQVLDLSTQLQQVQAENAVLEHKVAQ-------LNGL---S 101 Salpingoeca rosetta...
KAE9046946                    130 PAEEKVAE-LVSGLTQASEQvAlmqKKIGEL--------------NAKCILLKQRKSAVSTELVKTNTSKAKLEQL---C 191 Phytophthora rubi...
A0D4Z8                        107 NTQTNQLNEYQEKYSKVVDEEKQKKTELVEGFQQEIKDISTKMEEVSNAKHKSQAENEALKEKMKEIQEHVEKRDKIFDE 186 Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00047689A 122 KALTAQYQEQINTNKELQEKEKQKRTELAEQFQQRIKDIQSSVEEKSRDRIQKEKENEILKEKLKEITAQQQTTELIFST 201 Tetrahymena thermophila SB210...
EFA75417                      162 KEVQKRNDEVMEYSKKTAVEEDQKRRDLSDKFNATLKDVSSKLNDFNDQNERQAKYIEELQDRIKSFEEISQKSNVKFDS 241 Heterostelium album PN500...
EDQ92893                      131 RGLQQQNKLIKEENDRVFSAAEEKRKQLSAQFQASLDDISEKIKADEAHKLKTVQQSEELQKKFEEAMQRYQLGEAHYQK 210 Monosiga brevicollis MX1...
EFA04014                      127 RELQKQNKQIKEENLVKIKEEEERRKEVSSKFADKLSDINNMMDENKEKSEKLREENLRMTARLADLFKQFKKREEDITR 206 red flour beetle...
A0D273                        100 QEIDFNAKKINETIKKLPEIEEANRKSMKDKFYEDVKDVKDKIQQEDTDAQKFAEENLKIREEMQALIAQYEQKEKDFWE 179 Paramecium tetraurelia...
Q8RXD7                        169 RELQRQNKMLMEECKRVSTEGQTLRSDLSTKFQDAIMDVSIKLDEQKNESLTQLKENEMLRTKLKHLADQFMLSEQQHEQ 248 thale cress...
Q84VE3                        192 REFQRQNKMLKEECRRVSTEGQNMRMELSDKFNNAIKDVSVKLDEQKNECIAQLEENNLLRSKLKDLADQYNITQQKYAH 271 Japanese rice...
XP_004994135                  102 RRLAEQRTVIEKQAEAMVKQEEAKRAELTQKFQASLADISARVEESSKEQKQRDEYHQAMQAKIDAFVKQSEIREEQVAK 181 Salpingoeca rosetta...
KAE9046946                    192 RELQKQNKLIVSESRRIADEEDQKRRELSAQFQKTIEDVSAKMDKQGQDYVASLKENENLQQKLKGFLEQYTVREEHFQR 271 Phytophthora rubi...
A0D4Z8                        187 ELNKLDSQRKERETKI---------FEQINNISQSLg--tTDNSEDLLQKIKEEEALVEAHLNPHLQKAEE---FQQIIE 252 Paramecium tetraurelia...
WGS:AAGF:cds.TTHERM_00047689A 202 QIKKKELEMQLQEAKLg-------qEFELIKQQAQL----VSKFQEEIDKQKELDVKLEERLNVYLEQDKK---FQDIMV 267 Tetrahymena thermophila SB210...
EFA75417                      242 VLKKTEAETSILILKL---------HQQIEMTNRENa--kAIKLKEELDRLTAENLIQKEKVKYYEDNFSQ---FQDIIQ 307 Heterostelium album PN500...
EDQ92893                      211 QLKMRDLQVQLAEAKQ---------AQAELSRNEQVt--mVQELQTKLKEKEVTESSLKTQLASYAQKFEQ---FQETLT 276 Monosiga brevicollis MX1...
EFA04014                      207 MSQQLELERQFAQATItkmelemraQNELNAKEQEVmkcnLEKSEANCSVLLQTVKGLQDHIEVYKNQYQD---FESTMT 283 red flour beetle...
A0D273                        180 KVKLNEEEQKNDTKKYmeqfekmqgDAQKAMQEKQL-----------IQDAQKQLNDKKMKLQVYKGKQNE---FVETFE 245 Paramecium tetraurelia...
Q8RXD7                        249 RLKQKTLELQISALKIk-------qHEEKLIHEQSQ----MKVYADQVSQLLSTEKNLRLQLTSDGDKFQQ---FQDALV 314 thale cress...
Q84VE3                        272 QLKEKMLELELADLKMq-------qHQEKTAQEQTQ----MQLYADQVSQLMSTEKNLRLQLAADGERFQQ---FQDALT 337 Japanese rice...
XP_004994135                  182 LLKTKELEKQLAEAKLqqelenkkvLQQQLAVQGKA----IDEYKASSQSLFDEFKKLSDQATAQQKELQKqrkAAGRMK 257 Salpingoeca rosetta...
KAE9046946                    272 QLEAKDLTVQLAETKL---------QHQVELTTREAe--kVKITLDKAKEFSDREVQLQVQLNSYSEKFDV---VQETLT 337 Phytophthora rubi...
A0D4Z8                        253 KTNQQFNLYKNETEKLAQQCRSLEQKSQACQRKCEKSDIYIVDQAKEYQKLQVQYKQKQEQINSLLTLKSTLQSG 327 Par...
WGS:AAGF:cds.TTHERM_00047689A 268 ESNSKFTNYKQAHDSLIDSQKKTESSINELKKKNEKTDFTLLDMVEKNVKLKEDLKKQLDQLSGLENLYAILEKQ 342 Tet...
EFA75417                      308 KSNEKFLSFKNDMEKVTKANRSLEKDNKQLHSKIEGTNKALINTMTE-------LTQQKKQNETLKNLCKTLTTE 375 Het...
EDQ92893                      277 RSNNVFGSFKAEMEKKAKELKQREEENSRWRVRLEKTNVALASLKAEHEATLQENRAQQAKTEKLEQLCRALQQQ 351 Mon...
EFA04014                      284 KSANVFDNFKAEIATMNKQIATLEKETQFWKNKFNDSMKALIEVSELKKNQDLYVQSLERKVEQLNKLCRQIQVD 358 red...
A0D273                        246 KSTSTFQNLTVEFLKLAFKVKEDEEKSILNQQRADKANLLTVEIAQKNADLKQQIENIEKEKDKLRAEILELNNQ 320 Par...
Q8RXD7                        315 KSNEVFETFKQEIDKMSKAIKELRKENAFLKNKTEKSDITLIELVEERERLKKLLEKTKKQKDKLESLCRSLQAE 389 tha...
Q84VE3                        338 KSNEVFETYKKEMEKMVKLIKDLKKDNEFMKSKCENSDVALVKLIEERELMKKQVDKFKNQKEKLESLCRSLQAE 412 Jap...
XP_004994135                  258 QLEKEMGEWRNAFERLNKQCTAFKDAHDKQQELSGLLKDKLTSTVAERNKLLEEVASLKKLTRALSGSCKEVQSQ 332 Sal...
KAE9046946                    338 KSNQMFTTFREEMDKMAKTTKKLEKENLALRKKCAQYDSGAIASIQEKVTSAEETQKLQEKLKKLESLCRHLQAE 412 Phy...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap