Conserved Protein Domain Family
Plasmod_dom_1

?
pfam09715: Plasmod_dom_1 
Plasmodium protein of unknown function (Plasmod_dom_1)
These sequences represent an uncharacterized family consisting of a small number of hypothetical proteins of the malaria parasite Plasmodium falciparum (isolate 3D7).
Statistics
?
PSSM-Id: 401596
View PSSM: pfam09715
Aligned: 4 rows
Threshold Bit Score: 73.2477
Threshold Setting Gi: 74815577
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8I2D6    266 SFFKKIKLIMNILDDTHSDLLVNNHITNGGIFSPEFVpIGVLSSMTAACPLIGTVTLPYIARTINFM 332 Plasmodium falciparum 3D7
XP_966003 146 SFFKKLKLIMNILDEVHSDLLINNSVTDGSIFSPELVpISVLSTMTLACPPIGTVTLPYITNRINFL 212 Plasmodium falciparum 3D7
CAX64189  178 SFIEKIKFVCDAFDDLFIEKILDFHLQKKTSEFLRIT-METLVAQYLAFFPFSLARFRYLVDRINFF 243 Plasmodium falciparum 3D7
Q8IFL4    137 TFFKKAKLVLEAFDNIFIDKLIDANIHNKKSELKEDV-IDNSLALCGSL-ILAIPIFSYFCKRINFF 201 Plasmodium falciparum 3D7
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap