Conserved Protein Domain Family
PHA_synth_III_E

?
pfam09712: PHA_synth_III_E 
Poly(R)-hydroxyalkanoic acid synthase subunit (PHA_synth_III_E)
This entry represents the PhaE subunit of the heterodimeric class (class III) of polymerase for poly(R)-hydroxyalkanoic acids (PHAs), carbon and energy storage polymers of many bacteria. The most common PHA is polyhydroxybutyrate but about 150 different constituent hydroxyalkanoic acids (HAs) have been identified in various species.
Statistics
?
PSSM-Id: 370627
View PSSM: pfam09712
Aligned: 17 rows
Threshold Bit Score: 253.154
Threshold Setting Gi: 502680488
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:ADGE:HMPREF0389_01600.1  41 DFLEMQKNYMNFFS----SFMQPTSNfgempfpFmgmNQ----WNETQksmneyfdkfkqYYNPLEIGKtFSPAVKDVFE 112 ...
PRJNA210423:M911_13580       11 EWLDAQRKYWDAWL----DMSRKAMGgq--------sNQp--nWPQGLd-----------QWWQIASQG-MPGGNNQMMD 64  ...
WP_015258053                 10 QWLEAQRRYWDAWM----DMTRRGLEta---tpTpegTTp--pWATAMe-----------QWWKAVAPA-TPKPANELLE 68  ...
jgi:Mmc1_1169                14 GWSEMQKQTWDTWSktawDMLSKGGT-------PqqaANpmrfWQESM------------KPWMSMMGGePVQQMPWLVQ 74  ...
DSC:DSC_10540                21 raeALGRTAWEAWG----QALRKAAAvp--------lEIaapaWQQVP------------GGWPGWTPPqGVNDGD-VME 75  ...
Q8P8S9                       10 NFEDKARQYWSAWG----DAMRHGQSasaaqppPgpaGEtpqdWRKAV------------DWWSQVLPTqAAPQAQEAIN 73  ...
WP_012916138                 11 DFEAMARQYWDAWS----AILRQGSAasaa----apmREng-sWREAI------------DAWAQWLPRsTSTHTEDAVA 69  ...
WP_015767633                 16 aWADMQKRMWGDWS----SLLQNLPGg---------sEGpveaAKKGV----------------AAASKgTNEAARMLMD 66  ...
BAI94015                      8 tWTQSGNDIWKNWF----DLMSGSGV--------------------------------------SETDKnSQSHSGGITE 45  ...
WP_015145457                 18 AWADTGTQMWKSWF----NLMGLAPT--------------------------------------AETVAdAKPAFKYVAQ 55  ...
WGS:ADGE:HMPREF0389_01600.1 113 KMMNANTYYLNMYQLWRElentnikpatdemkkfSAMLVEKYNPIfKDMVVPLLPQEFQPLIRNTFdlfktYIDTSVDFY 192 ...
PRJNA210423:M911_13580       65 QMMQMSRNYFAMAENFYK----------------GANGQTDATQA-VTQWLDQMTSAFKNMGLGQA--------PGKDIN 119 ...
WP_015258053                 69 HMVNVGKGYFSMVEGLCK-----------------GGPATDLPEM-IENWTRMMSEAFSQGGQGLNpfaqiAREGGRKGI 130 ...
jgi:Mmc1_1169                75 ALSGQSDAFMKFSEQFTQafsn---------qagATSGPTQGWAAqVEQAIANLKKMFDPq---------aFLGDTPSAA 136 ...
DSC:DSC_10540                76 RSEGIARHWFGRMQHVAAqfad---------rdnTPEEIVAAWRK---ALGATEARPYPDLFSSLFgpgafGLEGLGEQW 143 ...
Q8P8S9                       74 RFRTQAGDWYGTMQQVAAqfag---------rdtSASAVSDAWRH--------------------------AVQGQGEQL 118 ...
WP_012916138                 70 RFQQHAGDWLGAMQQVAVgfag---------rdaSSAEVADAWKR--------------------------QVQSQRQQC 114 ...
WP_015767633                 67 RMTSSQGAMNRVMDFFFKsmkivapn-leankdwRPDL-KGFAEQwAKESTAMLERSF-GMGSHLGnlsstLSKDLPDAM 143 ...
BAI94015                     46 QMAKNQASLMRFLQFSFEawkdilpk-veagtnwEQTL-ENYSQQ-IRQQMEQYMSVPTKMTGSGStmgklYMEQMQKFN 122 ...
WP_015145457                 56 RFVDNQDLFVRFLRLSYKawtdifpk-vesgedwQQTL-SKYTEQ-IRQQFDQFFTGTLRVSQDTAqlwqlYLKETQKFN 132 ...
WGS:ADGE:HMPREF0389_01600.1 193 TPWTN------------NYTNLRDLFV--EgMLDDKAKLGKFFELWREQ--FDKTFGVILLSPSFGINKELIEQQNKTFD 256 ...
PRJNA210423:M911_13580      120 PFWQMpm---------dTWSRAGSSFM--P-MPGDFMQALRPAARPPYGdvVQEQMDRFLSVPGVGYTRESQEQYQDLAK 187 ...
WP_015258053                131 AFWDLpf---------dTWSRTLSGGM--P-FPGDFMKAFETG----KAtdLRAQLEGFLSAPAIGYGRESQEQYQRLAR 194 ...
jgi:Mmc1_1169               137 AMWGMpm---------eGFQQFFSALNl---NPAGGLGGFNAQAMGTPQqaMRSQIEKFLSMPALGYHREAQEQQQQGVR 204 ...
DSC:DSC_10540               144 MPWLEa---------------------------------------------LRGPLDEWAAMPAFGPAREHQQRWKALVQ 178 ...
Q8P8S9                      119 MQWTLgslhggskggfdPWLQEAAQALq----------------------rWREDNAAWLEMPAFGLNRNHQSRWQTLAR 176 ...
WP_012916138                115 LQWLLgslggagqatldPWLQQAAHWMq----------------------gGQRDSSPWLQMPGFGPARNHHARWRALTK 172 ...
WP_015767633                144 GPWLS------------FLMQAASSGHvgEaMLGGTSGINRLLSMEGDA-----ALAGVGEIPLFGASREKNAKLLRLVD 206 ...
BAI94015                    123 QMWMN--------------YSGAAMVPmvEaMMGKSEAFIELNNLYWEQl-YQPSLGNLLQSPMFGITRELNSTLMSHFQ 187 ...
WP_015145457                133 QLWAS------------ALLSSSGLIS--KtVTGTSTPWIELNNLYWNLl-YEETFGSLMQSPILGPTREFNGKLVRAFD 197 ...
WGS:ADGE:HMPREF0389_01600.1 257 TYVDMVLLGIDFITRILAVQNENIDDIIKKYFEMVEKGSQPKSFSEFYKYWAEELEHILESYFATPEYSNLLGQLSSVAM 336 ...
PRJNA210423:M911_13580      188 LMMEYQQAMQQYQQAFAKVGLDSVDRFRARLDDAGRQDTPITSMRALYDEWVDVSEEVYGEFVMSEEYAKVYGDMVNSLM 267 ...
WP_015258053                195 LLLNYEKAMGEYQAGFANLGSRSLDAFRRRMESAAQEGTPINSVRDVFNIWVDACEEAYAEYASSEDYAKRYGRMVNALM 274 ...
jgi:Mmc1_1169               205 YWMEYQQAFFDYLVLMSQVGSKSLDELRNLLLDEPEK-LNVSTLKALYDLWVKCAEEAYGEVTASEEHALIHAKLINAMM 283 ...
DSC:DSC_10540               179 TQQALREAAESCQRLLEEASRQAYVLFEQKLGKRAESAAPLDSARALFDEWIDAAEDAYEKMALSPEFSQVYAALANAQM 258 ...
Q8P8S9                      177 AQQDYQAQSQAYAEQLKAAIDQAFARFERKLSEHETSGSQLTSARALFDLWIEAAEESYADVALSDQFREVYGGFANAHM 256 ...
WP_012916138                173 AQQEYLAQSQSYMALLHAAIDRAFVVFEEKLRAHEDPGRQLTNARAMFDLWIDAAEEAYAAVALSPEFRQVYADFANAQM 252 ...
WP_015767633                207 AVVDLRKNSLTFHTAFGDALAKAVEATVEELGKVAAKGEKITAVRQLMSLWYRTADKSLLVTFNTQEFLDKQNAFTAAQQ 286 ...
BAI94015                    188 AWTNFYRASNDYQVVLADIQVRAFEKLIEKLAEGVSKGEKVETWRQFQQLWSVAIDDVFEETFCSEDKLKIRGRFINSLN 267 ...
WP_015145457                198 AWTDLYQATINYQIVLANVQIRSFEQLMRELVSLAEKGKTVKNWREFQDIWSQVADDVFAQAFCDEENLKIRGKFLNSLN 277 ...
WGS:ADGE:HMPREF0389_01600.1 337 DYKIEMQKLTEKYLEETPLVTRSEMDSLYKTIYDLKKELRNAK 379 Filifactor alocis ATCC 35896
PRJNA210423:M911_13580      268 AVKRQGTRLMDEVTESLNMPTRREVNTLHRRLQESRREMHQIK 310 Ectothiorhodospira haloalkaliphila
WP_015258053                275 AVKQQGARLVDEWLEAMSVPTASEIATLQRRLHDTRAAYQTLr 317 Thioalkalivibrio nitratireducens
jgi:Mmc1_1169               284 QLKQHQQQVSAGLYKSLNLPDRQELERAHMGVQQLKRKSFELA 326 Magnetococcus marinus MC-1
DSC:DSC_10540               259 RMRAGMQREVEQVGDMLGLPSRSEVDAAHRKIQELERALRGLm 301 Pseudoxanthomonas spadix BD-a59
Q8P8S9                      257 RLRAALQQEVEQVSERFGMPTRSEMDAAHRRIAELERAVRRML 299 Xanthomonas campestris pv. campestris
WP_012916138                253 RLRALLQREVEQVCEQMGLPTRTELDAAHCRIADLERRLRRLE 295 Xanthomonas albilineans
WP_015767633                287 QFKLAQRAVVEDIFRGLDMPTRSELDETYQVIHELKKEVRALK 329 Candidatus Accumulibacter phosphatis
BAI94015                    268 AYRLEQQKLMEISMRSLNLPLRSEIDEMHKTIYQLRKEVKSLK 310 Arthrospira platensis NIES-39
WP_015145457                278 TYRLQQQELLELWMKLAGMPVRSEVDEMHKNIYELRKEVKNLK 320 Pleurocapsa minor
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap