Conserved Protein Domain Family
YtfJ_HI0045

?
pfam09695: YtfJ_HI0045 
Bacterial protein of unknown function (YtfJ_HI0045)
These are sequences from gamma proteobacteria that are related to the E. coli protein, YtfJ.
Statistics
?
PSSM-Id: 401583
View PSSM: pfam09695
Aligned: 13 rows
Threshold Bit Score: 184.891
Threshold Setting Gi: 501031391
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7MPE0           24 SLGNPVPSVSVASYGEIVLQG--KGTAFQPWASSQMLGKVRVIQAIAGRSSSKEMNAPLMQAITAAQFSADHYQTTTIIN 101 Vibrio vulni...
Q5E822           24 TLNKEVPSVSIEQYGEIFFKN--SAATYQNWNTEQLKGKVRVLQAIAGRSSAKAMNADLMSAITLEKFPETEYQTTTIIN 101 Aliivibrio f...
Q6LV67           25 QLGQKTPNVSVADKGEIVLSN--DEIAYQEWDNSDLVGKVRVIQAIAGRSAAKEMNAEFIEAIKVAQLPNENYQTTTIIN 102 Photobacteri...
Q9CP94           24 QLNQPLASVNVAEDGELSVKG--EAVQYHAWHSAQLVGKVRVVNHIAGRRDVKERNQALIEAIKGAQFDRAKYQTTTIIN 101 Pasteurella ...
Q7MYV8           24 TLEQQVPAISVSDKGELLLNN--NKFSYQNWDSGKLIGKVRVIQHIAGRSAAKEMNAPLIEEIKRADFSKEKYQTTTIIN 101 Photorhabdus...
wugsc:KPN_04609  24 VDGQRVAPVGVADRGELILDK--DKFSYKNWNSAQLAGKVRVVQHIAGRSSAKEKNANLIEAIKAAGFPHDRYQTTTIVN 101 Klebsiella p...
Q6D148           30 VLNQWVPPVGVADRGELQYLN--NQFSYKNWNSAQLPGKVRVIQHIAGRTSAKEMNDPLISALKAANLPHDYYQTTTIVN 107 Pectobacteri...
tigr:AHA_3554    21 KESAQVPLVNISDKGELVLKE--KEISYQPWQSKVLAGKVFLIQHIAGRSSAKELNAPMIEAIKAAKLPHDKYQTVTIIN 98  Aeromonas hy...
WP_012083470     19 ELGKVPPSVELSGASG-------GKVDGTAWSSSMLKGKVHILFYV--DPDERDLNKALTQALKKRHFDRKKYASVAVIN 89  Sulfurovum s...
Q87JM8           24 SVGQTTPSVSIDTYGEMTLQG--DDVAYQPWATQQMLGKVRVIQAIAGRSKAKEMNAPLMSAITAAHFPEDQYQTTTVIN 101 Vibrio parah...
Q9KP29           24 TVGSPVPAVGVEKHGEIVLQD--NNINYQKWRSADLLGKVRVIQAIAGRSSSKEMNAPLMAAITAAKFPAESYQTTTIIN 101 Vibrio cholerae
WP_009847759     24 SVGATLPAVDVSNYGEIVLND--GNTGYQAWATNDLLGKVRVVQAIAGRSSSKELNAQLMAAITASKFAEDSYQTTTIIN 101 Vibrio
WP_002210162     24 QDNQRVPPVGVRDKGELDYDKttNQFNYKNWNSSQLPGKTRVIQHIAGRTSAKEMNAPLIDAIKQANLPRERYQTTTIVN 103 Yersinia pse...
Q7MPE0          102 QDDAIWGTGSFVKSSAQDSKKEFPWSSMVLDENGVVASSWQLDKESSAIIVQDKQGKVLFVKEGALSSDDITQVLELIKA 181 Vibrio vulni...
Q5E822          102 QDDSIWGTGGFVKSSAEESKEEFSWSSMVLDEHGKVAKAWDLQPESSAIIVQDKEGKILFVKEGKLSNDEIKQVIALIHT 181 Aliivibrio f...
Q6LV67          103 QDDSIWGTGGFVKSSAEDSKRDFSWSSMVLDASGSVQSAWDLQKESSAIIVLDKQGNVLFIKEGKLTSTEVKQAIMLVKE 182 Photobacteri...
Q9CP94          102 ADDATFGTGSFVKSGAEKGKKANAHSQVVLDQRGAVKAAWQLKEKESLVVVLDKAGKVKFVHEGALSTAQVQEVIGLIGE 181 Pasteurella ...
Q7MYV8          102 INDAIFGTGPFVRSSIEDSKREFPWSQFIADSNGVAKKAWQLEAKSSAIIVLDKNGAAKFTKEGALNSSEIKQVIELVRK 181 Photorhabdus...
wugsc:KPN_04609 102 TDDAIPGTGMFVRNSIESNKKLFPWSQFIVDSNGLVRKAWQLDEKSSAIVVLDKNGRVQWAKDGALTQQEVQQVIDLLHK 181 Klebsiella p...
Q6D148          108 TDDAIIGTSMFVRSSLEDNKKAFPWSQFIVDSNGNVRKTWQLQPQSSAIAVLDKQGKVRFVKDGALSGQEVQQVMSLLRQ 187 Pectobacteri...
tigr:AHA_3554    99 SNDAIWGTSGFVKSSAEDSKKEFPWSAMVLDAKGMARNAWDLAPESSAIILLDKEGKVLFAKDGQLDANNIATVMGLIKS 178 Aeromonas hy...
WP_012083470     90 L-AATWLPNVILESKLKAKQKEFPDTIYVKDKKKVVLKKWDLADDNSDILIFDKSGKLIYKKFGKLSDKEIKSVLALIEK 168 Sulfurovum s...
Q87JM8          102 QEDAIWGTGTFVKSSAEDSKKTFSWSSMVLDKNGVLATTWDLQQESSAIIVQNKQGEILFVKEGALTQDEVTHVIELIKQ 181 Vibrio parah...
Q9KP29          102 QDDAIWGTSSFVKSSAQDSKKEFPWSSMVLDEFGLVAQAWQLQAESSAIIVQDKQGNVLFVKEGALNEADIQTVLGLIQQ 181 Vibrio cholerae
WP_009847759    102 QDDAIWGTGSFVKSSAESSKEEFPWSSMVLDEDGTVASSWALKEESSAIIVQDKQGKILFVKEGALNDSEVTQVIELIKA 181 Vibrio
WP_002210162    104 TDDAIIGTAMFVRNSIESSKREFPWSQFIIDSKGNVAKAWGLTEKSSAIVVLDPQGNVKFVKDGALTSAEVQQVIDQLHQ 183 Yersinia pse...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap