Conserved Protein Domain Family
TrbI_Ftype

?
pfam09677: TrbI_Ftype 
Type-F conjugative transfer system protein (TrbI_Ftype)
This entry represents TrbI, an essential component of the F-type conjugative transfer system for plasmid DNA transfer that has been shown to be localized to the periplasm.
Statistics
?
PSSM-Id: 401567
View PSSM: pfam09677
Aligned: 9 rows
Threshold Bit Score: 107.116
Threshold Setting Gi: 570286309
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Saro_4004          46 VAALVAAGLWGAWVTKSVLGGPKtPAIAKVQLSGIVGEYVQAQARSATPPEQVTTETRAFMSEIQRNLERRGA-AGQIVL 124 Novosp...
Q2G6C0                 25 GAGMVGQVLWGVWATDKLLTLEK-REVVTVQLSRILGDFIEAEARAGRPPEETRLRVQAYLKAVEASVQTLGR-EGRTVL 102 Novosp...
Q2NDH3                 18 VAVLVAALLWGAWLTQQVTSSPK-QRIVTVRLAETIGTFVEEAARADADPAVVQAASLAYLKAAEAAVADMGR-DGRVVL 95  Erythr...
Q2N5I6                 15 VLAITGALLWAAWVSR-ELSEPR-QKIVTVRLAETISTFVDAEARDGRDPEASQARVLAFLKASERAVREMGT-DGRIVL 91  Erythr...
goetting:Loa_02967     11 VLAVFGAFTVFYGVA------TQ-KSIVIFDKEEVLSQFIRQLAEVKATESQVDQSTRRFNSVLNKVLVELAKqKKAIIL 83  Legion...
WP_013200019           32 LAAGVLLLAAGAGISQLIATHTQ-RDAVVFDMRGTIDAFKQQSARRELDENSARALTQRFSQALDCSLQAWQQdHNALVL 110 Erwini...
Q93GN2                 22 IPGCLGMVVLNAAISYGIVRLNT-PVTVAFNMKQTVDAFFDSAGQKKLTEAQSKALSGRFNAALEASLQAWQReHHAVIL 100 Salmon...
wugsc:KPN_pKPN3p06018  23 VALVLFALATSAFLSRVVLEYST-PRVVAFDMKKTLDSFMDSVSQKQLTEAQSKALSDRFNDALEKSLAEYQQqHHVVIL 101 Klebsi...
ELS:G432_20700         36 GLMVLAALVWGMWVTKLLVTPTQ-DHIVSARLSTIVGEYVQAQARSASPPAQVEAEMRKFMASLDTELQRRSA-NGQIVL 113 Sphing...
jgi:Saro_4004         125 VGEAVVAGNVPDITADVRREVYARV 149 Novosphingobium aromaticivorans DSM 12444
Q2G6C0                103 VAEAVVAGSTPDLTGSVRADVMRRM 127 Novosphingobium aromaticivorans DSM 12444
Q2NDH3                 96 VAEAVLAGAAEDATPELERRIADEl 120 Erythrobacter litoralis HTCC2594
Q2N5I6                 92 VGEAVLAGGVPDATDELRVRIIRQL 116 Erythrobacter litoralis HTCC2594
goetting:Loa_02967     84 RKNDVLAG-GIDITDEVRMKLSQAM 107 Legionella oakridgensis ATCC 33761 = DSM 21215
WP_013200019          111 TAGAVVSP-AQDITPVIQADIARRM 134 Erwinia billingiae
Q93GN2                101 VSPAVVQG-APDITREIQQDIARRM 124 Salmonella enterica subsp. enterica serovar Typhimurium
wugsc:KPN_pKPN3p06018 102 VSPAVVQG-APDVTRNIQHDIARRM 125 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
ELS:G432_20700        114 VGEAVLTKNVPDITDKLRHAVYasg 138 Sphingomonas sp. MM-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap