Conserved Protein Domain Family
Cas_Csx9

?
pfam09658: Cas_Csx9 
CRISPR-associated protein (Cas_Csx9)
Clusters of short DNA repeats with nonhomologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry describes archaeal proteins encoded in cas gene regions.
Statistics
?
PSSM-Id: 370604
View PSSM: pfam09658
Aligned: 2 rows
Threshold Bit Score: 793.514
Threshold Setting Gi: 74504399
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5JGB3  23 MSWVVMDAGIEPDEEELADTLEGALKSLGSRVKIHTSKMGRNDRSSFDKVLKAWFGRSAPETYGELFELVVTETIKLLRD 102 Thermococcus kodakare...
Q5JGB3  23 MSWVVMDAGIEPDEEELADTLEGALKSLGSRVKIHTSKMGRNDRSSFDKVLKAWFGRSAPETYGELFELVVTETIKLLRD 102 Thermococcus kodakare...
Q5JGB3 103 GNIDPGESLSTIKTDKNGTYLGIAYNGEQAILPAIIKQPEYYERQSGFLSPTTGQKAQIRMDPLWFSFMALGFFTSFAGF 182 Thermococcus kodakare...
Q5JGB3 103 GNIDPGESLSTIKTDKNGTYLGIAYNGEQAILPAIIKQPEYYERQSGFLSPTTGQKAQIRMDPLWFSFMALGFFTSFAGF 182 Thermococcus kodakare...
Q5JGB3 183 IGGKYYLMTKPGIEVFWPYEVEEIIEKGILPLTGAGASGRISLSTEELYEMKLAMKLAEEGRDVIEEVYPVTLHLISLEG 262 Thermococcus kodakare...
Q5JGB3 183 IGGKYYLMTKPGIEVFWPYEVEEIIEKGILPLTGAGASGRISLSTEELYEMKLAMKLAEEGRDVIEEVYPVTLHLISLEG 262 Thermococcus kodakare...
Q5JGB3 263 QVYTELKTTQLNLTGLSEYMEEYVNRIESASMGGLPILVELKAGNATIQKYPLWALVDIAERELWKGVNGDGEMLAYIFV 342 Thermococcus kodakare...
Q5JGB3 263 QVYTELKTTQLNLTGLSEYMEEYVNRIESASMGGLPILVELKAGNATIQKYPLWALVDIAERELWKGVNGDGEMLAYIFV 342 Thermococcus kodakare...
Q5JGB3 343 KDLYRAINSGRRELIRDAVFRLFRQGRALLEGSGRASGEFRKVMKTFMWQEHLEVLL 399 Thermococcus kodakarensis KOD1
Q5JGB3 343 KDLYRAINSGRRELIRDAVFRLFRQGRALLEGSGRASGEFRKVMKTFMWQEHLEVLL 399 Thermococcus kodakarensis KOD1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap