2H7O


Conserved Protein Domain Family
Rac1

?
pfam09632: Rac1 
Rac1-binding domain
The Rac1-binding domain is the C-terminal portion of YpkA from Yersinia. It is an all-helical molecule consisting of two distinct subdomains connected by a linker. the N-terminal end, residues 434-615, consists of six helices organized into two three-helix bundles packed against each other. This region is involved with binding to GTPases. The C-terminal end, residues 705-732. is a novel and elongated fold consisting of four helices clustered into two pairs, and this fold carries the helix implicated in actin activation. Rac1-binding domain mimics host guanidine nucleotide dissociation inhibitors (GDIs) of the Rho GTPases, thereby inhibiting nucleotide exchange in Rac1 and causing cytoskeletal disruption in the host. It is usually found downstream of pfam00069.
Statistics
?
PSSM-Id: 401535
View PSSM: pfam09632
Aligned: 3 rows
Threshold Bit Score: 496.527
Threshold Setting Gi: 545472893
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2H7O_A        11 ITPKKLRELSDL---LRTHLSSAATKQLDMGGVLSDLDTMLVALDKAEREGGVDKDQLKSFNSLILKTYRVIEDYVKGRE 87 
Q9RI12       440 ITPKKLRELSDL---LRTHLSSAATKQLDMGGVLSDLDTMLVALDKAEREGGVDKDQLKSFNSLILKTYRVIEDYVKGRE 516 Yersinia pestis
WP_021709243 433 ESPVKEKALQDAyhnLREHLTASSTNNLRQGYAFNDLVTTLTLLNKAESQGLSSSDKFRSLDNLMTKTNKVMVDYVKRNL 512 Vibrio azureus
2H7O_A        88 GDTKNSSTEVSPYHRSNFMLSIVEPSLQRIQKHLDQTHSFSDIGSLVRAHKHLETLLEVLVTLSQQ-GQPVSSETYGFLN 166
Q9RI12       517 GDTKNSSTEVSPYHRSNFMLSIVEPSLQRIQKHLDQTHSFSDIGSLVRAHKHLETLLEVLVTLSQQ-GQPVSSETYGFLN 595 Yersinia pestis
WP_021709243 513 ANDGTNSGELSIKFQDGIEGKSTQSFLANIERGLEAPSSFADIRSLEREQQLVETMFTVLLSSTEKdKTPIRAEIYSLLN 592 Vibrio azureus
2H7O_A       167 RLAEAKITLSQQLNTLQQQQESAKAQLSILINRSGSWADVARQSLQRFDSTRPVVKFGTEQYTAIHRQMMAAHAAITLQE 246
Q9RI12       596 RLTEAKITLSQQLNTLQQQQESAKAQLSILINRSGSWADVARQSLQRFDSTRPVVKFGTEQYTAIHRQMMAAHAAITLQE 675 Yersinia pestis
WP_021709243 593 HLAEVKKALSSRVDTLKAEQANAASSVVSLLDSSQEWFTQAKQTLENFDKVTPRVKFGTNESVQAHQQMISAHATMALQE 672 Vibrio azureus
2H7O_A       247 VSEFTDDMRNFTVDSIPLLIQLGRSSLMDEHLVEQREKLRELTTIAERLNRLEREWM 303
Q9RI12       676 VSEFTDDMRNFTVDSIPLLIQLGRSSLMDEHLVEQREKLRELTTIAERLNRLEREWM 732 Yersinia pestis
WP_021709243 673 VSQSIGKIKQFAHDARPLLVALGERPLVDHSLTFQRERLREAATVAERLSRLEFEWV 729 Vibrio azureus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap