2HFQ


Conserved Protein Domain Family
DUF2024

?
pfam09630: DUF2024 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF2024)
This protein of 86 residues is expressed in bacteria. It consists of four alpha helices and two beta strands. Its function is unknown. One UniProt entry gives the gene name as Traf5.
Statistics
?
PSSM-Id: 401533
View PSSM: pfam09630
Aligned: 23 rows
Threshold Bit Score: 111.562
Threshold Setting Gi: 300604507
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HFQ_A          23 MQIHVYDTYVKAKDGHVMHFDVFTDV---RDDKKAIEFAKQWLSSIGEEGATVTSEECRFCHSEKAPDEVIEAIKQNGYF 99  Nitrosomonas ...
WP_012792705     1 MKVSVFDTYVQKKNGAVMHFDILVPSd-lKDLEKIHTYGRQYLAQKGQEGQTLSTNECRFCHIEQADDNVVADIDRQGYS 79  Chitinophaga ...
WP_014773678     1 MKVAVWDTYVKRKDGKLMHFDIIVPQe-tDNQETIYGFGKEYLQGKNLKHLEITSKECRFCHIETIKPDWETAIMEKGYY 79  Belliella bal...
WP_013306845     1 MKVSVWDTYVKRKDGTTMHFDILVPSn-lKNEHSIYGYGKEYLKGKSFKTNDLTTKECRFCHIEQATEEIILSVEEKGFA 79  Maribacter sp...
jgi:Runsl_5064   1 MQVAVWDTYVTKKDGSVMHFDIIAPDh-iKDSTIIYTFGKDYLQSKNQGNQPLTAKECNFCHIEKATDEMVLSIQQKGYY 79  Runella slith...
WP_014034077     1 MKVAVWDTYVTKKDGSVMHFDIIAPEe-iRDTALIYGYGKEYLKTKAQEGRALTSKECRFCHMETVRPQWEAEIKQKGYF 79  Muricauda rue...
jgi:Halhy_2768   1 MRAAVFDTYVPTQQGGIMHFDIVVPAg--TAFELVSSWGANYLVSKGQEGQPLTSKECSFCHIEEASLAMEEAFKRQGYY 78  Haliscomenoba...
jgi:Nmar_1575    1 MDFHVFDTYVKAKDGHTMHFDVVTDN---SNVEKAISYAKEWLNTIGEENSKVTTEECKFCHTQSVPEDIEIEIMTNGYF 77  Nitrosopumilu...
WP_014166408     1 MKVAVWDTYVTKKEGDVMHFDIIVPQeivRNPAIIYNYGKEYLKTKGQEGQKLTSEECKFCHIDSLEPQWEEEIHKKGYF 80  Flavobacteriu...
jgi:Nmar_1229    1 MEIHVYDTYVKAADGHTMHFDVITGE---KDHDKAISYGKEWLKSIGEENATMTQNECQFCHSQGAPEPVEQAIKENGYF 77  Nitrosopumilu...
2HFQ_A         100 IYKM 103 Nitrosomonas europaea
WP_012792705    80 IIEM 83  Chitinophaga pinensis
WP_014773678    80 IYEM 83  Belliella baltica
WP_013306845    80 VIEM 83  Maribacter sp. HTCC2170
jgi:Runsl_5064  80 IIEM 83  Runella slithyformis DSM 19594
WP_014034077    80 IVEM 83  Muricauda ruestringensis
jgi:Halhy_2768  79 IIEM 82  Haliscomenobacter hydrossis DSM 1100
jgi:Nmar_1575   78 ISKM 81  Nitrosopumilus maritimus SCM1
WP_014166408    81 IIEM 84  Flavobacterium columnare
jgi:Nmar_1229   78 IQKM 81  Nitrosopumilus maritimus SCM1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap