Conserved Protein Domain Family
Cas_NE0113

?
pfam09623: Cas_NE0113 
CRISPR-associated protein NE0113 (Cas_NE0113)
Members of this minor CRISPR-associated (Cas) protein family are encoded in cas gene clusters in Vibrio vulnificus YJ016, Nitrosomonas europaea ATCC 19718, Mannheimia succiniciproducens MBEL55E, and Verrucomicrobium spinosum.
Statistics
?
PSSM-Id: 370585
View PSSM: pfam09623
Aligned: 12 rows
Threshold Bit Score: 165.689
Threshold Setting Gi: 121697669
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q65S15           16 SPAVVTETLYALVTEKNf-----IPTEIQVI--TTIQGKNKLLSALLgieggrkerkgaLAEFIEDYGSqygfsAIHFDE 88  [Mannheimia]...
Q7MC40           26 TPQVITETLYGIHTEQQenhqwlWPEEIQII--TTRLGKEQILLGLLtkdsd---gysqLEKLCHDYQRp----VPYIDE 96  Vibrio vulni...
jgi:Hhal_0625    18 TPQVVTETLYALAQEGAh----aLPDRIEVI--TTTEGRRRLALTLLaehg----ghgyLDRLCADYGIdr--gALAFDV 85  Halorhodospi...
WP_012174174     35 SPQVITETLYVLHQSGR------EVHAIHVI--TTREGKDRIFSDLLage------dgrYHRYLNEYGInp--eTIAFDH 98  Desulfococcu...
Q2LQV9           12 SPQVLTETLYALHQQGQ------IVQSIQVI--TTRQGKEKINAYLLspt------dgqYYSYLKDYGInp--sSISFCA 75  Syntrophus a...
Q2FPZ3           20 SPPVITAGIDALDE---------PVSDLVLL--ATKDEQVLAGCDVV---------------------------KLGLKS 61  Methanospiri...
WP_012258164     13 APAVITEAIELLEEQSL------HPDGVVLL--YTEDYDVLSSLELL----------------------------MKHLP 56  Chloroflexus...
jgi:RoseRS_1446  13 APAVVTEAVDLLTQQNC------RPDGVILL--RTEDHDVREAYELL----------------------------ATHLP 56  Roseiflexus ...
WP_011956599     21 QPQIVTFALDALLARGE------PITDVYLIhlSLTNPRTRQALSRL------------QQEFPNDYYAht-nrRCRLRR 81  Roseiflexus ...
jgi:Caur_2270    21 QPQVVTFALDALLARGE------PIQEVYILhlALTNERTRQAWQRL------------QREFVDDYYAg---rRCRLRQ 79  Chloroflexus...
BAF60112         24 EPQVVTITLDLLLAGGW------TIGETVVI--YTKTPRVQEALVII------------EEEFKREAYP-----GIKLRA 78  Pelotomaculu...
Q8R6W7           24 EPQVVTIALDELLKKGY------PLSKVIVI--YTKSPKVLDALRIL------------NDEFLKEFY------KMEFTK 77  Caldanaeroba...
Q65S15           89 SCIHI--IEDTSGEKLPDIRTPQENEFAADNIVKLVGSLCQGEE-SQLHVSIAGGRKTMGFFMGYALSLYGRKQDSLSHV 165 [Mannheimia]...
Q7MC40           97 STIYV--IPDAQGNPVADARSKQDHEALASFIVRHVAELCAQDD-IVLHASLAGGRKTMTFFLGYALALFAREQDRLSHV 173 Vibrio vulni...
jgi:Hhal_0625    86 DSIHV--VGGADDEPLADIVTEADNAAAADRIHERIRTLTEQPG--RLHVSLAGGRKTMGFYAGYSLSLYGRGHDRLSHV 161 Halorhodospi...
WP_012174174     99 THVHV--VADTHGVERPDILTEADNERLLALCLGMAFELTKDPD-TAVFFSIAGGRKTMSACLTLAAQFYGRPQDRLYHV 175 Desulfococcu...
Q2LQV9           76 ENIHV--IKDRNGIEIDDIAGEDDNERLLELCLSLTFQFTSDSQ-NTVFFSIAGGRKTMSACLMTAAHLYGRPHDRVYHV 152 Syntrophus a...
Q2FPZ3           62 RYPRI--RVHVELLPFDDISSDVENLTFMAIAARVIKKERESYGcERILLNVAGGRKNMCITLALLGQLLN--VDGVYHI 137 Methanospiri...
WP_012258164     57 AHCEIswIVPISVGTYHDIDSTKAAVEFMQIACTQLRTYRNN---HRLFVSIAGGRKVMSALLALAVQFYG--AECLFHI 131 Chloroflexus...
jgi:RoseRS_1446  57 QHDNLtwVEPVSIGQYGDVDTPEAAVEFMQETCRILKTYRDAG--YRLFVSIAGGRKAMSALLALAVQFYG--AERLFHI 132 Roseiflexus ...
WP_011956599     82 APV------GVNGVELTDIRTAADAEVAWQSIRTLIADLKNE-G-RRLHLCLSGGRRMLALLAMSAAALLCDHQDRIWHM 153 Roseiflexus ...
jgi:Caur_2270    80 VPI------GANGSELTDIRTTTDVEIAFQAIRQLIVDLKTN-G-RRLHLCLSGGRRMMALLATSIAALYCDHQDRLWHM 151 Chloroflexus...
BAF60112         79 VAV------ASAEGMTGDFCTDEELQSLLRVLYTEVRHLRQA-G-RVVHLCVSGGRKVMGIMGMVVAQLLFGPDDYVWHL 150 Pelotomaculu...
Q8R6W7           78 VPVKL----YSRDEVIEDFLTEESIKALLSTIYKEVRELKQN-G-FTIHFLISGGRKIMGIIGMLVAQLLFGDEDRLWYL 151 Caldanaeroba...
Q65S15          166 LVDEQFET---LPNFYYRKPYSHIIINRDGVEL----DASKANVMLAEIPWVRLGLGVPEGLKH--QAISYSESVKNAQA 236 [Mannheimia]...
Q7MC40          174 LVDEEYEN---NRHFYYPTRKTHVIPGRGENSQl---DASKANVTLAEIPFIRHKHMLPKESLTclTTRSYRALTKTQNA 247 Vibrio vulni...
jgi:Hhal_0625   162 LVNPPFES---HPDFFYPPPTPATLQLPGRNDIi---STAEAEVRLAELPFVRLREELGEELPH--QGLSFSEAVERAQQ 233 Halorhodospi...
WP_012174174    176 LVSPDFES---SREFFYPPKESKTIALKAKNGQayykDTRYAEINLISVPFVSIRDSLSKDVLK--ASKPPGALLLSLIR 250 Desulfococcu...
Q2LQV9          153 LVSPEFES---NRDFFYPPRESVSIELMDRNGEqyvkETRFARITLTSVPFISVRNRIEDDLLK--EPQDPPTLMLSLIR 227 Syntrophus a...
Q2FPZ3          138 -VNHEVKLfnqHLERMRPTMMRLFRAEKEEDKImiyaDNREMFEYILYPP----------------------KNEYELIR 194 Methanospiri...
WP_012258164    132 WVPPWLEEegeIGQLRGLQPEQINARLHPPLVNrdpkDR----PQLVDLPFIALFPMLPDIREAlaGGTPIDKNVKSMLV 207 Chloroflexus...
jgi:RoseRS_1446 133 WVPPWLEAegeIAQFRNLPEEDLIQKLHPPLNTmtpeDR----PRLVDLPFIGLFPWLEDIRDAlkGVVSPERSLKTLLQ 208 Roseiflexus ...
WP_011956599    154 HTPEE---------TLQRVKDGALMHVDPSDG-----------VQLIQTPIVPWGACFPA--LRalALTSMQAVQEQLQR 211 Roseiflexus ...
jgi:Caur_2270   152 HTPET---------TLQRVKDGAQMHVQPADG-----------VSLIQIPLTPWGAYFPG--LRllAQPDSRSIQDQLQR 209 Chloroflexus...
BAF60112        151 ITEGW------------QPGAGRQLHLPPDKG-----------VWLVPVPVLRWNE--AGMLMQavAELKDPAEVMAWQE 205 Pelotomaculu...
Q8R6W7          152 ITEGW------------EPGNERKLHLSSEEK-----------VWLVQIPVIRWSE--ASTLMRtvAEIGDPSEVEAWYK 206 Caldanaeroba...
Q65S15          237 LlsQ 240 [Mannheimia] succiniciproducens MBEL55E
Q7MC40          248 L--Q 249 Vibrio vulnificus YJ016
jgi:Hhal_0625   234 VliP 237 Halorhodospira halophila SL1
WP_012174174    251 EetP 254 Desulfococcus oleovorans
Q2LQV9          228 EepP 231 Syntrophus aciditrophicus SB
Q2FPZ3          195 IptL 198 Methanospirillum hungatei JF-1
WP_012258164    208 StgL 211 Chloroflexus aurantiacus
jgi:RoseRS_1446 209 AnnL 212 Roseiflexus sp. RS-1
WP_011956599    212 FaaI 215 Roseiflexus sp. RS-1
jgi:Caur_2270   210 FlsD 213 Chloroflexus aurantiacus J-10-fl
BAF60112        206 KlsR 209 Pelotomaculum thermopropionicum SI
Q8R6W7          207 KltK 210 Caldanaerobacter subterraneus subsp. tengcongensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap