Conserved Protein Domain Family
DUF2391

?
pfam09622: DUF2391 
Putative integral membrane protein (DUF2391)
This entry is found in Nostoc sp. PCC 7120, Agrobacterium tumefaciens, Rhizobium meliloti, and Gloeobacter violaceus in a conserved two-gene neighborhood. Proteins containing this entry appear to span the membrane seven times.
Statistics
?
PSSM-Id: 401528
View PSSM: pfam09622
Aligned: 34 rows
Threshold Bit Score: 224.77
Threshold Setting Gi: 378782966
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:GEI7407_1532   32 ELVRGASGGFLFGIPLLYTMEVWWIGSYTEPPLMLAILIGTYGVIFLIDRTEGFRKhkGRSWMETAAESTEALAIGLACS 111 Geitlerine...
MPITM:COCOR_01523  22 eyGRGIAGGLLFSLPLLYTMEVWWAGFTSHPGNVLGYLVATYVLLLGYNRYGGFRR--DVYWFDVFTDSMEELGLGLLVS 99  Corallococ...
jgi:Glo7428_4069   16 eYLRGIAGGLLFSLPLLYTMEVWWTGFIAHPLRLLIYVLATFSLLLGYNRYGGLRR--SAGPLEVAIDSVEEMGLGLIIA 93  Gloeocapsa...
WP_014188487       19 GLARAFAGALIFSLPMLMTMEMWWIGFTMTPWRLVLLLVLLIPLLVGLSVVSGFKT--NASLRDDIADAFVAIAVAVVMS 96  Azospirill...
Q2RSV4             21 PLGRAFAGALIFSLPMLMTMEMWSLGASMDPFRLALLLGVSVPLLIGLGRIAGFRE--TSCWSDDIADAFVAMVVATVTA 98  Rhodospiri...
Q930P0             18 GLGRAFAGALIFAVPVLMTMEAWALGFHLHPLRLALLLVATVPTLVLLHKYGGFRK--SVGLRDRIADAFVALLVAAIAA 95  Sinorhizob...
QianUST:TMO_a0039  18 GLGRAAAGALLFTLPILMTMETWQLGVTVPASRLLLLLALTLPLLVGLSRIGGFRR--TSSLAQDTADAAIAIGIAGVVA 95  Tistrella ...
WP_013178928       19 ELARAFGGALIFSLPMLMTMEMWWLGFYLERFRLALLVGLNVPLLVLLSRYIGFRD--SSCLLDDLLDTFVALAVGFVTA 96  Truepera r...
Q11KN8             27 GLARGFGGALIFALPMLMTMEMWWLGFYVDRFRLALLLIVNLPLLVLLSHHAGFEE--TFEWREDLRDALIAYGIGILAS 104 Chelativor...
HuoZJU:KKY_1060    17 GLLRGAGGALIFALPMLMTMEMWQLGMTLDRWRLLVLLVAGFPFLLLLSREIGFES--TRDWHEDVRDVTIAYGLGIVTS 94  Pelagibact...
jgi:GEI7407_1532  112 FVILVLLRQITGETPLDEALGKLILEGAPFGLGVSLARSLLSGDRLSNgdDDSQGSgdksdatvt--igkveinyHETLA 189 Geitlerine...
MPITM:COCOR_01523 100 LGVLVLIGRIGQGTSLQEAVGMVVVEAGTVAIGVSVGTAQLGGQHREEneEEDKKRles---------------adHVPG 164 Corallococ...
jgi:Glo7428_4069   94 AIFLWLLGRITADMSVDEIAGQIIVEAMTVAIGVSVGTAQLGGGEGDQ--QTDSGMksnsphddpdptpfltennGDFGG 171 Gloeocapsa...
WP_014188487       97 AVILGIFKVLSFDMPAREVIGKIALQSFPAAIGAMLARDQLGEK------SAESMQrqd---------------smTYGQ 155 Azospirill...
Q2RSV4             99 IAILAVFGALGPGMSAREMIGKVALQAVPGSIGALLARSQLGQE------SPEDGEpr-----------------sTYFG 155 Rhodospiri...
Q930P0             96 SAILFSFGIVDADMPLREIVGKVAVQIVPGSLGASLARAQLGP-------SPLEGDavp---------------epAYAG 153 Sinorhizob...
QianUST:TMO_a0039  96 AGVLGIFGVISDAMPASEVLGKLAIQITPGAVGALFGRAQLGA---SN--QEDAGReev---------------eeSYAG 155 Tistrella ...
WP_013178928       97 GAFLLLFSVLERGMSWDEVVGKVAMQVVPASIGAMLAARQLGIQ------ETEKGArd-----------------rGYGA 153 Truepera r...
Q11KN8            105 AVVLTIFGIIRPTMPMDEIVGKIAIQSMPASIGALLGRTQLGGR------KVEPQEgtk---------------geTYAS 163 Chelativor...
HuoZJU:KKY_1060    95 AAIMAVLAILGNPGSFSETAGKIAIQTFPAALGAMLARGQFGG-------DSEPSEke-----------------eTFGG 150 Pelagibact...
jgi:GEI7407_1532  190 DLSATLIGAVMIAFNIAPTDEVPMLVSAASPPWLIAIILTSLLISYGVVFAAGFTNQPKRYAQPGIFQRPGTETVVSYIV 269 Geitlerine...
MPITM:COCOR_01523 165 QLVISFCGAVLFAANVAPTEEIVMIAVETQPWCLLGIAVLSLLLGGLILFQSDFTRAHRFTRRRLRRDVFAG-TFVTYAI 243 Corallococ...
jgi:Glo7428_4069  172 QLTIALCGAVLFAANVAPTEEIIQIAVESNSWRLVGFALVSMLLGAMILFYSNFTGTQRFSKKRGFVNVIYG-TVVTYAI 250 Gloeocapsa...
WP_014188487      156 ELFLMAVGALFLGLNVAPTEEMVLLSYMMDPWREIALLLLSLVLMHAFVYAVELPGGSKPPGGVGFWSLFLRFTVVGYVI 235 Azospirill...
Q2RSV4            156 EVFLMAVGALFLSFNMAPTEEIMLISYGMGAWQKIALILASLAIMHIFVYEVGFSGQEAPGSETGGWSLFARFSVVGYCV 235 Rhodospiri...
Q930P0            154 ELFLMVVGALFLSVNIAPTEEVVLIAYKMNPWHEIALALGTLGLMHVFVYELEFRGTHNPEPGAGFVNIFFRYTIVGYCL 233 Sinorhizob...
QianUST:TMO_a0039 156 ELFVMVAGALFLSLNIAPTEEVVLIAWRMSLWQQLGLLAASLIVMHALVYQLEFIGGHGPRTEDGFWSLFLRFTVTGYVL 235 Tistrella ...
WP_013178928      154 ELVYMVVGALFLAFNLAPTDEMVLISYQFTPWHALLLVLASLVIMHAFVYAVAFRGQEAVPEATPVGSLFLRFTVVGYAV 233 Truepera r...
Q11KN8            164 ELFLMAIGALFLGLNVAPTEEMILISYKMTEWHAVLLILLSLLLMHGFVYAVEFKGESTLGPETPWWSAFLRFTLAGYAI 243 Chelativor...
HuoZJU:KKY_1060   151 EMLIMAAGALFLSLNVAPTEEMQLISFRMTPWHALALIPLSLAIMHAFVFAASFAGGSEISPETPWWSAFLRFTVSGYVV 230 Pelagibact...
jgi:GEI7407_1532  270 ALLASALMLWFFHRLsFSDPWSLWLRNVIVLGLPATIGGAAGRLAI 315 Geitlerinema sp. PCC 7407
MPITM:COCOR_01523 244 ALLSSALVLWFFGRF-TGNGLSVCVAQVVVLALASTLGASAGRLLI 288 Corallococcus coralloides DSM 2259
jgi:Glo7428_4069  251 ALVASAAILWFFGRF-DGMSLMTCLAQTVVLGLAATLGASAGRLLL 295 Gloeocapsa sp. PCC 7428
WP_014188487      236 VLAICLYLLWTFGRT-DGTGLAEIISATVVLGFPCAIGAAAARLIL 280 Azospirillum lipoferum
Q2RSV4            236 VLAVSLAVLWIFGRT-DGLGLEQLLGATIVLAFPGAIGAAAARLIL 280 Rhodospirillum rubrum ATCC 11170
Q930P0            234 VMLVNFYILWTFGRT-DGVGFSETLSAVVVLSFPGALGAAVARLIL 278 Sinorhizobium meliloti
QianUST:TMO_a0039 236 VALVSLYVLWTIGRL-DGTGPVDVAGVVIVLSFPGAVGAAAARIIV 280 Tistrella mobilis KA081020-065
WP_013178928      234 ALLVSLYVLWVFGRA-EGMGVAQLLMAAVVLGFPAAVGAAAARLIL 278 Truepera radiovictrix
Q11KN8            244 SILVCLYVLWTFGRT-DEQAATQIVMSVIVLGFPASLGAAAARLIL 288 Chelativorans sp. BNC1
HuoZJU:KKY_1060   231 ALLVSLASLWLLGQL-DGMAFERALRVAVVLGFPAAIGAAAARLIL 275 Pelagibacterium halotolerans B2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap