7ADK


Conserved Protein Domain Family
Myco_arth_vir_N

?
pfam09610: Myco_arth_vir_N (This model is not part of the current CDD release)
Mycoplasma virulence signal region (Myco_arth_vir_N)
This entry represents the N-terminal region of a family of large, virulence-associated proteins in Mycoplasma arthritidis and smaller proteins in Mycoplasma capricolum. It includes a probable signal sequence or signal anchor, which, in most instances, has four consecutive Lys residues before the hydrophobic stretch.
Statistics
?
PSSM-Id: 518966
Aligned: 5 rows
Threshold Bit Score: 33.3534
Created: 15-Feb-2025
Updated: 28-Apr-2025
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
7ADK_A          1 VYFLKKKKNKILTIALVASLAASVSFGSVLYY 32   Mycoplasma mycoides subsp. capri
Q6MSZ0          1 MYFLKKKKNKILTIALVATLAASVSFGSVFYY 32   Mycoplasma mycoides subsp. mycoides SC
WP_012498038    1 MSHAKKKKIAIIVLASTAALLAAGTVSGVLYA 32   Metamycoplasma arthritidis
WP_012498441    1 MSNSKKKKIAIATLAIATTLLAAGTISGVIYs 32   Metamycoplasma arthritidis
Q6MSY8          1 MYFLKKKKNKILTLVLVTSLATSLSFGSVIYY 32   Mycoplasma mycoides subsp. mycoides SC
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap