Conserved Protein Domain Family
Alph_Pro_TM

?
pfam09608: Alph_Pro_TM 
Putative transmembrane protein (Alph_Pro_TM)
This family consists of predicted transmembrane proteins of about 270 amino acids. Members are found, so far, only among the Alphaproteobacteria and only once in each genome.
Statistics
?
PSSM-Id: 401518
View PSSM: pfam09608
Aligned: 66 rows
Threshold Bit Score: 184.694
Threshold Setting Gi: 503716593
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012523315      9 TISAALTETTVHVSSDFRGASIVLYGAVFEPDSRPSDVVVIVRGPEEPV-RIARKMRVAGLWLNSRPVVFQGAPGFYIAA 87  Phenylobacte...
WP_013705437     31 SVTLKLNPAVVEINSFYQGCEVAITGTIPAG----HEAVAEIVGPTGEE-ILMRKGRRGPLWMNVGELKISGAPSLYLIL 105 Desulfobacca...
AEB09125         32 KVLTAASKRDIDISLFYKGDRVYFFGVNPVAG---SDLVVRLTAEKAEEiKLSMKGKVGPFWMTVKQYEVTNAPFIYKIH 108 Desulfobacca...
BAF60443         26 EIGLQVTPEQIDIGLNFKGSTLEIAGNVPPG----SDVCLKVESPPGTV-ALNRKGKVGPFWMTVDHVQAENVPKIYEVL 100 Pelotomaculu...
WP_015738557     22 aFALEVSPDKVGIGLNFAGDKVTVTGTLPAG----CDVYVEVLSPPVKV-PVNRLGHVGPFWLNKQKVEIKGVPKLYQVY 96  Ammonifex de...
WP_015756572     25 daNISVSPGEVDIGLSFKGADLAVSGKVPSG----SDVYIKVASPNDSVlQLSKKGKVSIFWMNVENTNVTNVPKLYQVM 100 Desulfofarci...
jgi:Desmer_3795  25 etQLTVSPEKVEVGLRFQGTTLNISGIVPDD----AGVYIKVISPNDAIlDLSKKGKVSLFWMNVENVSVTKVPKLYQIL 100 Desulfosporo...
CAS:Atc_0715     33 aLVVGTGIDKIAVTSRFTGRELLVFGALSHP----GAVVVVLRSPPSAL-AVTQKVQTGPIWLTGQKVTVQKLPGVVQIA 107 Acidithiobac...
tigr:AFE_2257    27 PLVVGTSNDLVKVTSHFTGRELLVYGALSQP----GQVIVLLRSPAATE-AMSRKTRTGPIWLTGARVTVTGAPGIWEML 101 Acidithiobac...
jgi:Hbal_0925    34 ELSAALSESKIKVDVDFSGTRITLFAVSDQWDNPSVTFAVALVGPQRPY-TITHHTKN-----NKERFVFVSAPAILSVA 107 Hirschia bal...
WP_012523315     88 SNRPLGEIANFGTLRRLGA--GVDHLPIRApaeqrvetRYGVRDVVVSSlgadyyDWRQAVVRLKQKAGLYDEDGR---- 161 Phenylobacte...
WP_013705437    106 AS------ASDLLTGAASW--GFGAMRQRIt-------VAGQVPAGQED------KLRDQFLRLKESEELYAAVPE---- 160 Desulfobacca...
AEB09125        109 ASKPLEQIISEDQAKELGL--GYDAVKSKMkmhlvrgdAA----PEDGE------ELFKGLLKIKQDANLYRIVEDdpqs 176 Desulfobacca...
BAF60443        101 STRPLEEI-PQKAREQMEVgpGYSYLKEHArvlrkqeeSKEVLSPAEAG------DYLNGLFEIYEKKAFYLVDAG---- 169 Pelotomaculu...
WP_015738557     97 TSCPLSQL-PPALREELE---GYQKAFRKAevydttgeGKRLLDRQAAL------PFLQFLAQEYQSKGLYAIREG---- 162 Ammonifex de...
WP_015756572    101 TSNPLSQM-PLDLQKQLGLdqGFSQIYSVGkvtkhteiGSEALSEEESE------NYIKSLIDIYKKSSLYLVKEN---- 169 Desulfofarci...
jgi:Desmer_3795 101 SSRPLGDL-TVDQKKVLGIdqDFSTVYQTAevtkhtdsGSIRLEKFEAK------DFVSSMISIFKKGGLYSLNES---- 169 Desulfosporo...
CAS:Atc_0715    108 ASAPLANLLPAQRRQQLGL--DLGDLVARA---------QFVPELQDRR------RWEQAVLAAKERTGSFALKDH---- 166 Acidithiobac...
tigr:AFE_2257   102 SSAPADQLLPLATRQLLGL--DPGHLSRQA---------SYQPEPADVA------AWQQAFLKNKLRRGDYVVQSQ---- 160 Acidithiobac...
jgi:Hbal_0925   108 TEAGKDDIETAKELNLAIInpRYSAMPEPD-----------------NMndpkleYWRQAFADLKTQKGLFNTNTH---- 166 Hirschia bal...
WP_012523315    162 -----GVRFV---DRGL-FRAEIALPAGAPTGVYRADILLFQDGKPVSGRVRTLTVEKVGLERTLYLWAHNRPWSYGLAS 232 Phenylobacte...
WP_013705437    161 -----GLKVSpakDGRLsVIGSFWLPANVKPDTYSVCLMAVAGDRLVERQCMALSVKMVGFPALFMSLAYQHSVIYGVLA 235 Desulfobacca...
AEB09125        177 tkeapRLEIT---EGKL-FKHYFTFPPAATEGKYQVESFSFQNGEMVGYGKDVIEIRKVGLEGWITHASQEYAVFYGIGA 252 Desulfobacca...
BAF60443        170 -----ALQNE---NGR--FHASVSIPAAIPPGKTKITAYAISGDRVVATGEFPLQVNSVGLVNWVRSEATANGPFYGLIA 239 Pelotomaculu...
WP_015738557    163 -----AVKVT---DGH--FQVTVDVPPGTPQGDIQVTAHFVKNGQVVGREATSFRVESRGLVRWLRVLAGTDGPVYGGLA 232 Ammonifex de...
WP_015756572    170 -----VVNVE---GQN--FNTTVKLPPNIPQEECKITVYAVKNGKLITSSSIPFKVSSVGLVKWLNMEAIYNGPMYGYMA 239 Desulfofarci...
jgi:Desmer_3795 170 -----AVKVK---DDR--FETSLELPANIPQEECDVTVYFIKDGKIIGTCSKTFNVETVGIVKWLNNMAIYEGPFYGFMS 239 Desulfosporo...
CAS:Atc_0715    167 -----AVKIS---DGRL-FSARLDLPASLPLGQYSLTTYLIRDGQVLAQSNERIDVEQVGLEQWVADVAEREPWLFGIGL 237 Acidithiobac...
tigr:AFE_2257   161 -----GVHIE---GGQL-FSARMALPASLPLGRYTLDTFLVRHGQVVARQEQHIEVQQTGFQAWIARFASQDGWLYGIVL 231 Acidithiobac...
jgi:Hbal_0925   167 -----GLQRL---DGGL-IRADIDLPAAAPPGMYDVRILLFQDDTLLAETQTPLLLERKGVENALFTLSLKHPIIYGFLA 237 Hirschia bal...
WP_012523315    233 VVLALAAGWAASAAFRR 249 Phenylobacterium zucineum
WP_013705437    236 VVIAILTGFVMGHLFKg 252 Desulfobacca acetoxidans
AEB09125        253 VLIALGAGLLVGMIFKK 269 Desulfobacca acetoxidans DSM 11109
BAF60443        240 VVVALLVGLVTGTLFNS 256 Pelotomaculum thermopropionicum SI
WP_015738557    233 VMLAIIAGLGVGMgfgl 249 Ammonifex degensii
WP_015756572    240 VLIALACGIAIALIFNy 256 Desulfofarcimen acetoxidans
jgi:Desmer_3795 240 VMIALVVGSVIAFLFif 256 Desulfosporosinus meridiei DSM 13257
CAS:Atc_0715    238 TLLLAVLGLGLGIVMQR 254 Acidithiobacillus caldus SM-1
tigr:AFE_2257   232 TLTLAAMGLGLGIVMQR 248 Acidithiobacillus ferrooxidans ATCC 23270
jgi:Hbal_0925   238 VLLGCSVGIGAAFlggg 254 Hirschia baltica ATCC 49814
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap