Conserved Protein Domain Family
Cyd_oper_YbgE

?
pfam09600: Cyd_oper_YbgE 
Cyd operon protein YbgE (Cyd_oper_YbgE)
This entry describes a small protein of unknown function, about 100 amino acids in length, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It appears to be an integral membrane protein. It is found so far only in the Proteobacteria.
Statistics
?
PSSM-Id: 401512
View PSSM: pfam09600
Aligned: 33 rows
Threshold Bit Score: 58.7452
Threshold Setting Gi: 291583728
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
UCNUF:Cenrod_0320  23 WRGLSLCIALTIMVVGSAYPFFFTLPGAPADkpvhHGYVMVLLWAMCAGLVHGVGFVPRWAPWRWLFSGWACLFALGLAA 102 Candidatus...
CAL93847           12 IRLLPLVAALAIMLGVTAWPRVLAGAQGGAD----HLAALALFWAMSAGFVAGVGFRPRGWIWRALFGAPACALGLALAV 87  Azoarcus s...
WP_015465694       20 TRLVSMTLALFLSVVLVVNPGHIAQSSAQLD----HGYLSLLMLALSAAFIHGIGFNPIFWLWKILFSPYFSWTILFGFI 95  Psychromon...
Q6FA35             38 amAISFLLALPLAAILLVNPSLMLDQQGHYN----HSILMLVMLGISGGFIYGVGFLPKFWLWKWLFSPLISWPLMLLGY 113 Acinetobac...
CCU73801           34 ARALSLVTALGLSGALLVMPHLVAVDTMSLK----HGPLSLAMWGISAGFVHGIGYIPEMRIWRFTLGPVIAWPIMMWTA 109 Thalassoli...
EPD97536           16 LRIISLLGALACAAVVVLYPRAIAEDATGVP----HGALVGMLFGMSILWVYGFGFTPQHRIFRYLLSPLLGWILLLGFG 91  Sutterella...
Q7VKT9             14 LKALSFILALLLFIVILLNPQVFASYFGGHV----PYLAIFVFYGMAILWIHGIGLDIHRTFWQLLFLPIMGYLIVISTL 89  [Haemophil...
ACL31773           14 LQALSFILSIAMFAMILLYSNTFALYFGGKI----PYLVAGVFYGMLILFVHGFGFEIKSTRWQMVFMPLLGYAIILPSL 89  Glaesserel...
Q65UN5             16 WRALSFILAILLTACFFFNIHQFTSELRTAN----PIWVVLILWSTVILWIHGMGFDIRSDLGKYLFFPIFGYLISFVAL 91  [Mannheimi...
jgi:Slit_1148      20 pRMLSLLLALALTGIILTYPRALG----HTS----HGMLSLTMLGICAGFIHGVGFIPETRLWRLLFGPWVAWALMGLGL 91  Sideroxyda...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap