Conserved Protein Domain Family
MamL-1

?
pfam09596: MamL-1 
MamL-1 domain
The MamL-1 domain is a polypeptide of up to 70 residues, numbers 15-67 of which adopt an elongated kinked helix that wraps around ANK and CSL forming one of the complexes in the build-up of the Notch transcriptional complex for recruiting general transcription factors.
Statistics
?
PSSM-Id: 401509
View PSSM: pfam09596
Aligned: 20 rows
Threshold Bit Score: 71.5268
Threshold Setting Gi: 699238932
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002433960    8 PKRQAVVDRLRRRIELYRRHHSATLPRYDDSANDvyEEQRQETLMLKQRYLESKAKKA 65   black-legged tick
XP_008187811    7 HKRQAVIDRLKRRMEGYRRHNQDCVPRYNNAFAE--QQNVQETLMLKQKYMETKTKRN 62   pea aphid
2_pfamImport    1 PKKQAVVDRLRRRIESYRRHQNDCVPRFDHSFNGvvEQNVQDTLLLKQRFLENKAKRT 58  
EDX06999      131 TKRMPVVDRLRRRMENYRRRQTDCVPRYEQAFNTvcEQQNQETTVLQKRFLESKNKRA 188  Drosophila simulans
XP_001861417   83 AKRQAVFDRLKRRIETYRRRQTDCTPRFEQTFNAvcEQQGNETSALQKKLFDAKNKRK 140  southern house mosquito
EFN87135       13 PKRQAVVDRLRRRIEGYRRRQTDCIPRFDQSFNGlcEQNIQDTLMLKQRFLESKAKRQ 70   Jerdon's jumping ant
EFX80326       73 PKRQAAVDRLRRRVEVYTKDHQDRFMHYERIGPAlcEQQMQESFALKQKYLDPKAKKT 130  common water flea
XP_002598282    7 PKRRAIVDRLRARIELYRKHHNECQARDVQTQAArlQQERQDTLVLHQRVCDSRTKKS 64   Florida lancelet
XP_001627503    8 PKHRVVVDKLRVRLTGYREHHNTCQSKQDRLQALreDQVRQDAAMLHQRAIDRSAVKm 65   starlet sea anemone
VTJ65261       73 PKHSTVVERLRQRIEGCRRHHVNCENRYQQAQVEqlELERRDTVSLYQRTLEQRAKKS 130  woodchuck
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap