Conserved Protein Domain Family
Pathogen_betaC1

?
pfam09593: Pathogen_betaC1 
Beta-satellite pathogenicity beta C1 protein
Cotton leaf-curl disease - CLCuD - is of major economic importance in cotton-growing areas of the far-east. The infectious agent appears to be a single-stranded DNA molecule of approx 1350 nucleotides in length, which, when inoculated with the Begomovirus into cotton, induces symptoms typical of CLCuD. This molecule requires the Begomovirus for replication and encapsidation. DNA beta encodes a single protein, betaC1. The intracellular distribution of betaC1 is consistent with the hypothesis that it has a role in transporting the DNA A of Begomovirus from the nuclear site of replication to the plasmodesmatal exit sites of the infected cell. The DNA beta-encoded protein, betaC1, is the determinant of both pathogenicity and suppression of gene silencing.
Statistics
?
PSSM-Id: 401507
View PSSM: pfam09593
Aligned: 36 rows
Threshold Bit Score: 130.755
Threshold Setting Gi: 126165534
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q08EU7         2 TIKYNTEKGMEFTIDVKITRDNSIIVQIELFSTQSPALAKKTFMIPYGHDGIITPFNFNALEGGIKNLLKIMYKDSNIGE 81  Tomato leaf cur...
YP_001210298   2 TITYSNGNGIKFIIDVRLQQ--FISVSVQVYSTNQAILTGFNCNIPYTYEQIIAPFDFNGTEEIIRNTLELMYEDSDVSN 79  Tobacco leaf cu...
BAF49383       2 TIIYNNGKGIKFIIDVRLQQ--FIKVQVQVYSTNQPVLTGIRCNIPYRYVQMVPPFDFNGTEELVRDTLELMYDDSDISN 79  Honeysuckle yel...
Q6I6F8         2 TITYNNGRGIKFIIDVRLHQ--IIRVIVQVYSTNQPVLTGFKCNIPYTYVQMVPPFDFNGGRGAYQGHTGIWYDRSDISN 79  Honeysuckle yel...
BAF75929       2 TITYNNGKGIKFIVDVRLHQ--LLKVIVQVYSTNKPVLTGFKCHIPYTYVQMVPPFDFNGAEELIRETLELMYEDSDISN 79  Tomato yellow d...
BAF64265       2 TITYDNGKGIKFIVDVRLHQ--IIRVLVKVYSTNQPVLTGFKCDIPYTYAHMVLPFDFNGTEELIRDTLELMYDGSEFSN 79  Honeysuckle yel...
AAL05305       2 TITFRSTKGVHFRVDVFLKDD-HIECRIEVTATKEAYLRKSTFIIPYHFADVFIPFDFNGSEEEIMHGLRNMFKDFTHQM 80  Cotton leaf cur...
ABN80228       2 TRFSKNREGIVFKVDVKLMQQQRISVQMQISSTRSPAISTKTFIIDYTYQQLHIPFDFNGLEGTITSTFKFHYWGSKAEE 81  Bhendi yellow v...
Q3L3M8         2 TTSGTNKKGVRFIVDVRIMENMKIFIHMRILSTKSPSLIKYEGIIQYTYEDIHVPFDFNGFEGSVIANFLFAYNGAKIEE 81  Cotton leaf cur...
Q4VYH1         2 TRSGINTQGVRFTVDVRIMEGMRLFIHMKLVSTRTPAIIKYEGIVKYTYGDLLIPFDFNGFEANIIANFLFAYNGAKIEK 81  Malvastrum yell...
Q08EU7        82 FRQEDMVETIDLLMMEEAPLVDIRIGDEYDVCTNVCV 118 Tomato leaf curl Karnataka betasatellite
YP_001210298  80 FQVEDMIETIDILMTEMFTDMGVETMRRCIVRHKYTV 116 Tobacco leaf curl Japan betasatellite
BAF49383      80 FKQEEMIDSIDMVMMHWLSDMGVDTVDKYVVRNTYTV 116 Honeysuckle yellow vein mosaic beta-[Japan:Kumamoto:1998]
Q6I6F8        80 FKQEEMIDSIDMVMMHWLSDMGVDTVEKYSIRCIHTV 116 Honeysuckle yellow vein betasatellite
BAF75929      80 FKQEEMIDSIDMVMMHWLGHMGVDTVDRYTIRCRNTV 116 Tomato yellow dwarf disease associated satellite DNA beta-...
BAF64265      80 FKQEEMIDSIDMVMMHSLTHMGVDTVDRYDVRSSYTI 116 Honeysuckle yellow vein mosaic disease associated satellit...
AAL05305      81 IRTEELVDVVDMVMAENVNVLGMDLLNHYRIINKSSV 117 Cotton leaf curl Gezira beta - [Sudan:Okra 44-2:96]
ABN80228      82 ILEEDIIHMVDIIIIENPEIMGMDVNEPVTIDNKIII 118 Bhendi yellow vein betasatellite
Q3L3M8        82 IEIEDIVHRLDILVLENPEILGMDVIEPYIFNKKFTV 118 Cotton leaf curl betasatellite
Q4VYH1        82 IDIVDIVERLDIFVLENHEIIGMDVIEPYVFNKTFTV 118 Malvastrum yellow vein betasatellite
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap