Conserved Protein Domain Family
HrpA_pilin

?
pfam09589: HrpA_pilin 
HrpA pilus formation protein
HrpA is an essential component of the type III secretion system (TTSS) which pathogens use to inject virulence factors directly into their host cells, and to cause disease. The TTSS has an Hrp pilus appendage for channelling effector proteins through the plant cell wall and this pilus elongates by the addition of HrpA pilin subunits at the distal end.
Statistics
?
PSSM-Id: 370573
View PSSM: pfam09589
Aligned: 3 rows
Threshold Bit Score: 91.3089
Threshold Setting Gi: 515700615
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Pmen_0031   2 AMDPINGGMQLFNQATSSLNMNNNIADAAGDSKSSKAMEDAMARSDASSARMIDLQSRHAEKMKVENTLQAMQSAEDDAA 81  Pseudomonas me...
WP_017133215   14 AVNGYNSVKETGNSIKGNAQNQSAAADLAGGGKAAEAQLAMMKMQDEQSARNIMLQGQAAMQTEQRNTLQAISSAQTDAA 93  Pseudomonas ag...
Q52473         18 AVGGVGGALQGVNTVASNATLQKNILLGTGDSLSVDAQAKASKESDANGAKLIAMQAQETMKKQTMDVLNAIQAGKEDST 97  Pseudomonas sy...
jgi:Pmen_0031  82 NKKISSTAQNAKGISY 97  Pseudomonas mendocina ymp
WP_017133215   94 NKEISNVAQTAKGISY 109 Pseudomonas agarici
Q52473         98 NKKISATATNAKGISY 113 Pseudomonas syringae pv. tomato str. DC3000
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap