Conserved Protein Domain Family
Phageshock_PspG

?
pfam09583: Phageshock_PspG 
Phage shock protein G (Phageshock_PspG)
This protein was previously designated as YjbO in Escherichia coli. It is found only in genomes that have the phage shock operon (psp), but it is only rarely encoded near other psp genes. The psp regulon is upregulated in response to a number of stress conditions, including ethanol, expression of the filamentous phage secretin protein IV and other secretins and heat shock.
Statistics
?
PSSM-Id: 401500
View PSSM: pfam09583
Aligned: 12 rows
Threshold Bit Score: 40.0306
Threshold Setting Gi: 645052682
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6D0Y7               1 MLEIFFVIGFFIMLMLTGVSLLGVIAALFVASLFMLIGGLFTMAIKVLPWLILAVAAVWLWRKF 64  Pectobacterium atrosepticum
WP_025423963         1 MLELFFVIGFFLMLLLTGISALGVLVALVVGSLAMLFAGLFVTAVKLLPWLLVALAAAWLWRAI 64  Sodalis praecaptivus
BAN94826             1 M-EILFVIGFFMMLLLTGVSLLGVIAALVVATVVMFLDGLFALVIKLLPWLVLAVVAVWLYRAF 63  Plautia stali symbiont
wugsc:CKO_03861      1 MLELLFVMGFFIMLMATGVSLLGILAALMVATAVMFLGGMFALVIKLLPWLLLAVAVVWVIKAV 64  Citrobacter koseri ATCC B...
wugsc:KPN_04437      1 MLELLFVIGFFVMLLVTGVSLLGIIAAIVVATALMFVGGLFALMIKLLPWLLLAVAAVWVIRAL 64  Klebsiella pneumoniae sub...
jgi:Rahaq2_4192      1 MLEILFVLGFFFMLMLTGISLLGMVAALVVAFALMMVGGFLAIVIKMLPWLVLAVVAVWIYRAf 64  Rahnella aquatilis CIP 78...
CAX57845             1 M-EILFVLGFFVMLLLTGISVLGIIAALVVATVVMFFGGMLAIVIKLLPWLALAVVAVWIYRAY 63  Erwinia billingiae Eb661
ACR67485             1 MLEVMFVLAFFMMLLLTGISLLGVIAALAVAALLLVFGGLFVLVIKLLPWLALAIVVVWLYRAL 64  Edwardsiella ictaluri 93-146
WP_010636066         1 MLEFIVLMLVLVGMALAGFTVLAMLLVSGVFVLFGALAGMFALIIKLAPWLLVLLVVCWFISSR 64  Aeromonas
JLExeter:vfu_A03138  2 MVDLIFILVFVASLLVTGLTVFGTLVAIAVAFGVLMLLSLLGFALKLLPWLIVIALGVWVYRHY 65  Vibrio furnissii NCTC 11218
Q7MHA1               2 MLELIFILVFAATLLVTGITMMTVFAATGIALVVMILLGMLGFVLKLLPWLIVIAVAIWFFKHV 65  Vibrio vulnificus YJ016
WP_009847904         1 MFELIFVLIFVATLLVTGITFMTVLAATGIALAVMLVLGMMGVVFKLLPWLIVIAVGVWFFKNY 64  Vibrio
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap