Conserved Protein Domain Family
DUF2374

?
pfam09574: DUF2374 
Protein of unknown function (Duf2374)
This very small protein (about 46 amino acids) consists largely of a single predicted membrane-spanning region. It is found in Photobacterium profundum SS9 and in three species of Vibrio, always near periplasmic nitrate reductase genes, but far from the periplasmic nitrate reductase genes in Aeromonas hydrophila ATCC 7966.
Statistics
?
PSSM-Id: 370569
View PSSM: pfam09574
Aligned: 7 rows
Threshold Bit Score: 55.1797
Threshold Setting Gi: 119865040
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
JLExeter:vfu_B00315  1 MSTLESVIWHILGYSAMPVIILSGFLAVAVLCIWLLSLTKDK 42  Vibrio furnissii NCTC 11218
Q7MD41               1 MSTLESVIWHVLGYSAMPVIILTGFAGVAAVSLWLLSLGKDK 42  Vibrio vulnificus YJ016
WP_013051696         1 MSTLENVIWHVLGYSAIPVIILGGFSVVAVASIWILSKTSDK 42  Shewanella violacea
WP_005301193         1 MSLLEQTIWTVLGYGAMPFIFLSGFVAVAVTCCLLLNAFGVK 42  Aeromonas
ABM04517             1 MSELESVLWHIAGYAAIPTIFVAGFIGVSVAAIIVLKISG-A 41  Psychromonas ingrahamii 37
UNSW:PCNPT3_09000    1 MSNLESIIWHTLGYAAMPVIFLGGFVGVFCVAAAILHFTGng 42  Psychromonas sp. CNPT3
Q5E3J9               1 MSTLESVIWHTLGYAAMPAIILGGFAAVSVFSIWLLSLKSDK 42  Aliivibrio fischeri ES114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap