Conserved Protein Domain Family
RE_HaeIII

?
pfam09556: RE_HaeIII 
HaeIII restriction endonuclease
This family includes the HaeIII (recognizes and cleaves GG^CC) restriction endonuclease.
Statistics
?
PSSM-Id: 401481
View PSSM: pfam09556
Aligned: 7 rows
Threshold Bit Score: 550.494
Threshold Setting Gi: 294472374
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9K764          8 GKAFEYACLQSLNNALSGTQKVVIEQNSALEVAMEKYHGSSEEMRNNMDLGADAATRVILRLEPQLTTPLSNVpLFLAIQ 87  Bacillus halod...
WP_020457764    8 GKAFEYACLQSIYNELADSQDVVIEQNSALEIARQKYENATPDMQNKMDLGADAAIRVILRLEPQLTTPLTNVpLYLSIQ 87  Clostridiales
WP_004011177    9 GRAYEYAWINSLFKTLHHTRNTQIAHNSSFYANQSAWNQIGGDMREVFQLSADSAVDAILQLEPMLSEDNPDV-LTLEFQ 87  Mobiluncus
WP_012741533  364 GRAYEYAWIKTLYKALCEMRKTKIVDNSSLHANEKAWMLMDEEMQQTFMISAEAAINEVLEMEPRLSENDNDE-LTLEFQ 442 unclassified L...
jcvi:PRU_0937   8 GRAFEYICVKCLEEEISKIRSVVVANNNNLIQDMNNWNCLDENTKTIMKKEALAAIPTLRELEPMIEDNSGDI-LTIRLQ 86  Prevotella rum...
CDD10695        9 GRAYEFICLLTLSQEINKIRKAEIEVNSAYHAAEHAWNTISDELKSILVQSATAAVSTIFDMEPMIVENSDDI-LFLKIQ 87  Clostridium sp...
CDD81622        9 GRAYEFVCLLTLNEEIGKLRPVNIVPNSSFIAAEHAWNQLTTEMKNIYKISSYAAVVQILDLEPRIIEKGEDV-LELQLQ 87  Bacteroides sp...
Q9K764         88 EDARGQQGDVRDVLCIRRQNEWEIGLSCKHNHTAVKHSRLSRTIDFGDSWFGIPSSQDYFDEINPLFDELDELKERGELW 167 Bacillus halod...
WP_020457764   88 EDARGQQGDVRDILCIRRQNEWEIGLSCKHNHAAVKHSRLSRTIDFGELWFGIPCSESYFIEINPLFDELEELREQGELW 167 Clostridiales
WP_004011177   88 PDRAGIQGDVRDIVIKRDAIEWEIGLSVKHNHEAVKHSRLSHKLDFGNEWFGIPCSQRYWDDVEPIFTCLAAKKAQGLKW 167 Mobiluncus
WP_012741533  443 KDGAGVKGDVRDIVIRRDDIEWEIGLSIKHNHDAVKHSRLSHKLDFGKEWFDIPCSNEYWGAVNPIFDMLKSEKENGSRW 522 unclassified L...
jcvi:PRU_0937  87 SDKEGIIGDVRDILIIRDSVKWVIGISVKHNHLAVKHSRLSNVLDFGNSWLGMPCSKTYWDEIAPIFAPLIKNRGKIA-W 165 Prevotella rum...
CDD10695       88 TDNEGKEGDVRDIVIARKDVKWEIGLSLKHNHFAVKHSRLAKGLDFGNKWFGIPCSENYWNDIKPIFNYLTEQKADNKKW 167 Clostridium sp...
CDD81622       88 ADFKGEDGDVRDILIIRRNIQWEIGLSLKHNHFAVKHSRLSQKLDFGAKWYGIPCSQVYWNSVKPVFDYLSQEKNKKTLF 167 Bacteroides sp...
Q9K764        168 RNIENKEERIYVPLLKAFIRELERLNNNNPGlIPERLLQYLLGSNDFYKVITHDRRRVTQVQAFNLYGTLNRNSGRERPI 247 Bacillus halod...
WP_020457764  168 RNISNKEERFYVPLLEAFIRELERLNQNNQGvIPERLLHYLLGRNDFYKIITIDNRRVTQVQAFNMYGTLNRNAGRERPL 247 Clostridiales
WP_004011177  168 SEIRDKDTTVYVPLLQAFIDELYRAYTANPD-MPRKMVEYLIGTRDYYKVVSHDRSHLTIISTFNIHGTLNRPSAITVAT 246 Mobiluncus
WP_012741533  523 SEIVQKDENVYVPLLQAFMDEVNRAYKEDKN-MPEKMIEYLIGKEDYYKIVSHDSKRLTLIHTFNMHDTLNKSSKDKVSE 601 unclassified L...
jcvi:PRU_0937 166 SALPNKESTVYVPLLKAFIKEINKDYEKDKT-VPSRMVEYLLGKYDFYKLIGIDSSKMTQLMAFNLRGTLNHASKTKVPS 244 Prevotella rum...
CDD10695      168 NELPSKDISVYVPLLQAFMDELNRSNALDSS-VPQKMVEYLLGEFDFYKVISIDSKRITRIQSYNMHGQLNRASKTIKPQ 246 Clostridium sp...
CDD81622      168 NNLPDKEKDVYIPLLKAFINEIIYQNQTHSD-LPRKLVEYLLGKYDFYKIISIDKRRTTQIQSYNLHGTLNQNSVCKKAS 246 Bacteroides sp...
Q9K764        248 VNVPQLIMPTRFFDISFKRDSRNTIEVTCDNGWTVSLRIHNASSRVEPSLKFDVRLTGVP 307 Bacillus halodurans
WP_020457764  248 INVQQLPMPTRFYNIGFKPGSRNTVLVALDNGWTISLRIHNARTEVEPSLKFDVQLVGVP 307 Clostridiales
WP_004011177  247 ISAPIVELPTELVTLKFKQGSTNTVEMYLNNGWQLSFRIHNASSRVEPSLKFDVQFIGMP 306 Mobiluncus
WP_012741533  602 IEVPVVELPTRLIDIGFKPKSNNTVEMILDNGWQLSFRIHSASTKVEPSLKFDVQFISMP 661 unclassified Lachnospiraceae
jcvi:PRU_0937 245 RKIPISLLPTRIISFGLKPKSNNTAELYMDNGWQFSFRIHNASTLIEPSLKFDIQIIGMP 304 Prevotella ruminicola 23
CDD10695      247 IHIPEACLPTRIVNLEFKPNSTNTVELYMDGGWQFSFRIHNAATKVETSLKFDIQIVGMP 306 Clostridium sp. CAG:349
CDD81622      247 IIIPTSSLPTRIVSLEFVPGRMNTVELYMDGGWQFSFRMHNAEKIVVPTLKFDIQIVGMP 306 Bacteroides sp. CAG:462
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap