Conserved Protein Domain Family
RE_Bpu10I

?
pfam09549: RE_Bpu10I 
Bpu10I restriction endonuclease
This family includes the Bpu10I (recognizes and cleaves CCTNAGC (-5/-2)) restriction endonucleases.
Statistics
?
PSSM-Id: 370555
View PSSM: pfam09549
Aligned: 8 rows
Threshold Bit Score: 283.94
Threshold Setting Gi: 493667137
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Osc7112_2676    87 QLKLDNSIIEEFIPILVTTVFaDSLKDkE-LSFGPTQCFSSLRFE-SSLKLSPKGGGMSIRAKEQDFAISR--KIFLKAS 162 Oscillato...
AHJ26447            87 QLKLDNSILEEFLPQVIYRSL-KGIDN-T-FEVGPKKTFAGLSFL-SSLGNPGIGGEPTLRTKNQDFVLGK--KLYLKTS 160 Nodularia...
jgi:PCC7424_5155    87 QLKLDNTILEEFLPQVVFRSL-RGIDD-S-FELGPRNTFSGLSFL-SSLGNLGQGGEPSIRTKDQDFILGK--KLYLKSS 160 Gloeothec...
jgi:Alvin_1613      85 QLKLDNSVLEEFLIHLIHPAIiPGLPEnLeLNVGPTRAFMSLSFNpSGVAALGEKPSVVVKVKDQDFILGK--EIYYKFS 162 Allochrom...
WP_006617479        85 RSNLHSSVLEEFMYYLF-RDLvQEISPhA--LLGKAHSFKDVFFRpPSYQEMLKKPYALIEIKDHDFAIGVsvETQMKCE 161 Arthrospi...
ESQ15656            86 QLKLDNTVIEEFLPYLITKSL-PQLGE-E-MYVGPQSCFSAAYFT-STLTRHENGGGLHIRTKDQDFTIAK--KLFIQTS 159 unculture...
HYCyano:ANA_C13580  90 QLKLDNTIIEEFLPYLINPVIvPEIENlA-VDIGPIKTFSSVYFE-SSLTFPALGGGLSVRSKNQDFAITR--KLYLKAS 165 Anabaena ...
WP_012259288        27 QLKLDNTVIEEFLPVLVSIAF-PDFPD-T-LDLGMKSCFGAIYFT-STAGIISTSPKARIRTKDHDFTISR--QMYLKAS 100 Chlorofle...
jgi:Osc7112_2676   163 HNQDFKETT-SREA-NIAYVAAECKTNLDKTMFQEGAATALDVKLSVPGAKYFLLCEWLDMS-PISSSLTAIDEILILRK 239 Oscillato...
AHJ26447           161 FDSQFTSSK-LVES-YLGYVCAECKTNLDKTMFQEAVATSRDLKLAVPSSLYFLVCEFLDMT-PVSITATQIDDVLIVRK 237 Nodularia...
jgi:PCC7424_5155   161 FDAEFQDYK-LIES-HLGYVCAECKTNLDKTMFQEAVATSRDLKIAVPGSLYFLICEFLDMT-PISIISTQIDDVLIVRK 237 Gloeothec...
jgi:Alvin_1613     163 PDHDFPDSTtASGViPLAVLAAECKVNLDKTMFQEASGTAARLKQGCPHAQYFVLNEYLDMS-PEDCRLTAVDNVYLLRH 241 Allochrom...
WP_006617479       162 GSPV----VeTHNW-DIPAVAIACKTYLDKTMLQDISTAAEQLKYKNPNAMYIVVAEWLKLTdSVNLRKYKIDQIYILRK 236 Arthrospi...
ESQ15656           160 YDPSFREQVlARET-YLGYICAECKTNLDKTMFQEASATAHDVKTAVPGAKYYLLCEWLDMT-PISTAPTDIDEVLLLRK 237 unculture...
HYCyano:ANA_C13580 166 HFPDFTQEK-SIIT-NLSYIAVECKTNLDKTMFQEGCATAHDVKTAVPGAKYFLLCEWLDMS-PISTAPTDIDEVILLRK 242 Anabaena ...
WP_012259288       101 FDPRYAQGVdQLEV-NLAYLCAECKTNLDKTMFQEACATAHDVKTVVPGAKYLIICEWLDMI-PVSTAGTDVDEVLILRK 178 Chlorofle...
jgi:Osc7112_2676   240 AKRLTSNIRKDFSTVKGRKKNKDSFVNHLDNNPFAPEVFMRFLKEIEGMIGKDELDEDD-VLSRGYF 305 Oscillatoria nigro-vir...
AHJ26447           238 SKRISANIRQEYKTPESRQQHRQEYADFIEMSKYYPDVFQKMIDKIQTLVDDTAPKVDQ-VLKRGHF 303 Nodularia spumigena CC...
jgi:PCC7424_5155   238 TKRMSSNIRQEYRTPEERQRHRQQYVDFLDSSQYYPDVFQRMINKIQALIDDTSPSMEN-VLNQGHF 303 Gloeothece citriformis...
jgi:Alvin_1613     242 AKRLPFNLRNDYDAVR-RQR---------DAHPIDPAVILRFVENIDAFVNAVWYDPNA-ALERGSF 297 Allochromatium vinosum...
WP_006617479       237 QKNTDREFR---------------YLESYQKNPIYSDVVQHLFLKVREFLISDWEGGISdGLNRGFL 288 Arthrospira platensis
ESQ15656           238 AKRVGSQVRRHYATYRGRQQVREEYTEYLSDNPFAPDVFRRLVSHIEGVLNDQDPDEGN-VLSGGYF 303 uncultured Thiohalocap...
HYCyano:ANA_C13580 243 AKRLNSNIRGNFATYEGRLDYRDYYIEYLKNNPFRVEVFKHLINNIRKLLKNEGLDESN-VLEVGYF 308 Anabaena sp. 90
WP_012259288       179 ARRLGAQTRSLFASYAGRVAGRELYARYLNDNPFAVDVFERFLTHVRLLLEDRSPDERD-VLERGWF 244 Chloroflexus aurantiacus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap