Conserved Protein Domain Family
DUF2379

?
pfam09543: DUF2379 
Protein of unknown function (DUF2379)
This family consists of at least 7 paralogs in Myxococcus xanthus and 6 in Stigmatella aurantiaca, both members of the Deltaproteobacteria. The function is unknown.
Statistics
?
PSSM-Id: 370553
View PSSM: pfam09543
Aligned: 20 rows
Threshold Bit Score: 108.164
Threshold Setting Gi: 122390077
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q1D3W7             3 EHRTWHEIRELNRRVTDLGEPLVLTDENRALLTNTASEVAITprEVTQALQDDVSAAALLKEIAKRIRVGSRRLSRAITE 82  Myxococcus ...
WP_014397108       5 leGDWHQLRVLDTRAQQEGT-VVLDDALRTLLRRTGPSVAMTtaEVDAGLHTPEAARTLLHQMRQRVTEGSRRLGDALHR 83  Corallococc...
Q096M2           137 kLSERSQLASLLYRI-NQGKPLKLTKEMRSFLRLAAAEAAISeaETEEALASPTSAAALVRKTLGRLRNGSKRLEHAISR 215 Stigmatella...
Q1D470             3 KTLDWNPIRALARRVLREGQPLVLSDEVRALLLRSAREVAIRdaDVGRALATDVDALKLLEAISDRIRKGSLRLSRTLSE 82  Myxococcus ...
mpitm:STAUR_6719   3 DALNWDDVRELAKRVFDAGELLLLSDEVLVILRRTAREVAIDaeEAEQALRTVPEATVLLGKMARRIRDGSHRLSRALVQ 82  Stigmatella...
Q1DD95             3 ESIDWDPVRELARRV-EAGEALSLTAEVRALLLRSAREVGIPeeDAHAAVAGVATATALLHETRRRIRDGSQRLMRALTG 81  Myxococcus ...
Q096M2             3 gKTDWAPIEALAQRVLEQGEPLELTADVRTLLRRSAREVAIPaqDVQQALRSLRTAKPLLRKIRKRIEDGSWRLMLAEHR 82  Stigmatella...
Q092A5             3 DKFGSELIDELEAHVLEDGEPLVLSDEVRALLRRSAEQVALSpgDADEALRSVPTATTLLQEISRRFKEGSKRLFEAQVK 82  Stigmatella...
Q098Z5             3 AELDWEPIRALGQRVIERGEPLELSDEVRALLQRSAEEVALSpeDTANALRSVPTATTLLEEITRRIREGSDRFWNAELR 82  Stigmatella...
Q09BJ1             3 TEIDWGPIRALGQRVIERGEPLELTDEVRALLQRSAEEVALApeDAQNALRSIPTATTLLGEIRRRIREGSAQLGAATLR 82  Stigmatella...
Q1D3W7            83 AIKHQEAGDLDAARAPFLELLNVEVVPFYRELAQVQLDAL 122 Myxococcus xanthus DK 1622
WP_014397108      84 MYRLRDQGDLDGARQQMRDLLAVEVVPYYRELAQGQLADL 123 Corallococcus coralloides
Q096M2           216 MLDLREVGDLEGARQQMRDLLAVETVPMYRRAAEENLAGL 255 Stigmatella aurantiaca DW4/3-1
Q1D470            83 AVRRRDAGDVDGARQLLHDALAVEVVPIYRDSLYAYVESL 122 Myxococcus xanthus DK 1622
mpitm:STAUR_6719  83 MHRLRDAGDLEGARQQMREVLAVEGVPHYREIVEGQLAEM 122 Stigmatella aurantiaca DW4/3-1
Q1DD95            82 ARRLRDAGDAAGARALLEDVLAVEQVPLYREQAELALEDM 121 Myxococcus xanthus DK 1622
Q096M2            83 ARRLQDAGDLEGARRQIERVLTVEVVPFYRQQAENVLARI 122 Stigmatella aurantiaca DW4/3-1
Q092A5            83 ASDLRDAGDLDGACRELEGVLSVEVVPLYRQRAADSLHAL 122 Stigmatella aurantiaca DW4/3-1
Q098Z5            83 ASDLQDAGDLDGAGRLMEEVLAVEVVPHYRRIAESQLRKV 122 Stigmatella aurantiaca DW4/3-1
Q09BJ1            83 AYDLRDDGDLDSACRQMEEVLAVEVVPLYREHAEAMLREM 122 Stigmatella aurantiaca DW4/3-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap