Conserved Protein Domain Family
RE_Eco29kI

?
pfam09517: RE_Eco29kI 
Eco29kI restriction endonuclease
This family includes the Eco29kI (recognizes and cleaves CCGC^GG ) restriction endonuclease.
Statistics
?
PSSM-Id: 370543
View PSSM: pfam09517
Aligned: 14 rows
Threshold Bit Score: 231.06
Threshold Setting Gi: 374653917
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_006616550     40 RFPGTGVYAIYCIRKTEIYSRFYLINR-TAFRAPIYVGKEVPKGWRKAMQSFSVNsQGYELNNRIREHSRSINLGEGLEP 118 Arthrospira ...
jgi:Ppha_2870    42 SFFGTGVYALYYTGSNPLYKRYAELNR-LSYGYPIYVGKAVPKGWRQARSSDNALnQSRELIGRLREHGRSISLGAQLSL 120 Pelodictyon ...
Q5F7H0           41 QFKGAGVYAIYYIGNNPLYKQYADWNR-LSYNAPIYVGKAVPKGWRQARNSDNALnQSTELFHRLKEHSRSIAAVSDLDP 119 Neisseria go...
Q9RZH4            5 LGQLLGAYILFYKGPHELYIPVTAANQ-QNFTQPIYIGKAVPKGDRTGEGAKKAVlE-NSLYKRLYEHSRSIAQVENLDV 82  Deinococcus ...
WP_015173920     38 lagYVGIYLLYYRGEFPLYSGIRVANQ-NSCCMPIYIGKAENPGKRTGKGS-----VAGGLIGRLREHRSSIRQTTNLDV 111 Calothrix pa...
ACR27352         40 QFFGVGIYAIYYVGDFEAYAPLAERNRnGALQAPIYVGKAVPKGARKGGGVGEV--RSKALYDRLREHAESVQLATNLDI 117 Burkholderia...
jgi:Dtox_1530    40 PFIGAGVYALYYTGPFSGYKELAAVNRdNQFRCPIYVGKAVPAGARKGGLGLEVD-HGQALQKRLAEHGESITAATNLDI 118 Desulfofarci...
jgi:Aaci_1133    35 PFEGAGIYAIYYTGDFSLYQKIAERNRnGRFEAPIYVGKAVPPGARKGGFGLDIP-PGQVLYRRLCEHAESIKQARNLDI 113 Alicyclobaci...
jgi:RoseRS_4009 312 IFEGAGVYALYYSGSHDLYASLALSS--GKEEKPIYVGKAVPPGARIGGYGLNTP-PGAVLFNRLREHALSIEQAQDLDL 388 Roseiflexus ...
jgi:Srot_1354    35 RFDGAGVYALYYTGGFAPYDKLAQQNRsHPGSWALYVGKAEAETRRKGDPNQTAVlDGPKLFHRIAHHRASIEKTGNLDP 114 Segniliparus...
WP_006616550    119 SDFFCRFMILEgkeSDFIGTVEAALIRIYQQIWNTLIDGFGNHDPGKGRYKQ---------------------------- 170 Arthrospira ...
jgi:Ppha_2870   121 EDFMCRFVIFEvegSDMISAIEAALIKLNKPLWNTAVDGFGNHDPGSGRYAQ---------------------------- 172 Pelodictyon ...
Q5F7H0          120 SDFMCRFVIFEgagSDMIGTIEAALIKLHKPLWNSCVDGFGNHDPGKGRYEQ---------------------------- 171 Neisseria go...
Q9RZH4           83 ADFYFKVVPTTlhlSAWV---ESVLISKFVPAWNRHIDGFGNHDPGSGRYNQ---------------------------- 131 Deinococcus ...
WP_015173920    112 ADFDFTVLAMA---VDLVAWGEAVLIRHFQPLWCSVISGFGIHAPGKGRGAQ---------------------------- 160 Calothrix pa...
ACR27352        118 KDFVCRFLVVD---DIWIPLGESLLIAKFAPLWNALIDGFGNHDPGSGRYNG---------------------------- 166 Burkholderia...
jgi:Dtox_1530   119 NDFYCRFLVVD---DIWIPLTESLLIERFQPVWNRVLDGFGNHDPGSGRYNG---------------------------- 167 Desulfofarci...
jgi:Aaci_1133   114 EGFYCRYLVVD---DIWIPLGESLLIQRFSPVWNQVLDGFGNHDPGSGRYSQ---------------------------- 162 Alicyclobaci...
jgi:RoseRS_4009 389 TDFRCRYLVVD---DIWIPLAETLLIEMYQPVWNTIVPGFGNHAPGKGRHKQpatcnlqpatcnlqpvtcnlqpvtcnlq 465 Roseiflexus ...
jgi:Srot_1354   115 DDFQVRFLVLA---PTWVPLAEQVGIRIHRPLWNVVVDGFGNHDPGSGRKEG---------------------------- 163 Segniliparus...
WP_006616550    171 -----AKSDWDVCHPGRSWADKCQG----------------IHADKKQLLQSIEI 204 Arthrospira platensis
jgi:Ppha_2870   173 -----AKSDWDVIHEGRAWANKCNG----------------KHAEKNAIMSNILL 206 Pelodictyon phaeoclathratiforme BU-1
Q5F7H0          172 -----AKSDWDVLHSGRVWADRLNG----------------IPNSYESILENINT 205 Neisseria gonorrhoeae FA 1090
Q9RZH4          132 -----KRSVWDQVHPGRSWATRMSNlaiydvaelrsrisarHHAKEVAVEKAIEE 181 Deinococcus radiodurans
WP_015173920    161 -----MRSMWDEIHPGRLFAVQLPG----------------NPVTVGSLQTQVGQ 194 Calothrix parietina
ACR27352        167 -----LRPRWDVLHPGRAWAEKCKA----------------REETQGHIVRDVQN 200 Burkholderia glumae BGR1
jgi:Dtox_1530   168 -----MMPQWDCLHPGRAWATRLKP----------------CQYTAEQVEQRVAE 201 Desulfofarcimen acetoxidans DSM 771
jgi:Aaci_1133   163 -----QRSRWDTVHPGRVWADRLTP----------------NAESLEKIVQAVEE 196 Alicyclobacillus acidocaldarius subsp...
jgi:RoseRS_4009 466 patcnVQPPTCNLQPSRSLS----------------------------ISCATLA 492 Roseiflexus sp. RS-1
jgi:Srot_1354   164 -----TRSRWDTLHPGREWAAKLRP----------------RLESETRINEDIVQ 197 Segniliparus rotundus DSM 44985
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap