Conserved Protein Domain Family
ThiW

?
pfam09512: ThiW 
Thiamine-precursor transporter protein (ThiW)
Levels of thiamine pyrophosphate (TPP) or thiamine regulate transcription or translation of a number of thiamine biosynthesis, salvage, or transport genes in a wide range of prokaryotes. The mechanism involves direct binding, with no protein involved, to a structural element called THI found in the untranslated upstream region of thiamine metabolism gene operons. This element is called a riboswitch and is seen also for other metabolites such as FMN and glycine. This protein family consists of proteins identified in operons controlled by the THI riboswitch and designated ThiW. The hydrophobic nature of this protein and reconstructed metabolic background suggests that this protein acts in transport of a thiazole precursor of thiamine.
Statistics
?
PSSM-Id: 401459
View PSSM: pfam09512
Aligned: 21 rows
Threshold Bit Score: 118.084
Threshold Setting Gi: 74563021
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q67T50                   7 LTRMAILMALGVASSSFSAIplfgAKLFPAQHAINVVAGAMLGPVYAGVVGLGIATIRILLGSGTLLAIPGTVFGAVLAG 86  Symbi...
Q8CZ02                  11 LTILSMMIALDVVLTPIFRI----EGMAPMSSVVNILAGIMMGPVYALAMATVTAFIRMTTQGIPPLALTGATFGALLAG 86  Strep...
Q03XM9                  10 IMVVTIMIALDIVLSPIFRI----EGMAPMSSVMNIIAGVILGPVYAVVMAVVTGIIRMLMLGIPPLALTGSIFGAFGAG 85  Leuco...
Q830K3                   9 VTLLALMIAMDVVLSPLMRI----EGMAPMSSVMNIIAGVLLGPLYGTLMALVCGLIRMTFLGIPPLALTGAVFGAFFAG 84  Enter...
Q8ESY9                   7 LTLMAVLVAIGTIGSQLLWFpagvARAYPVQHAVNVMAAVLLGPGPAVGVALMIGLLRNLLGLGTLLAFPGGMIGAFFAG 86  Ocean...
Q8R987                   7 MVFMALIIAIGTLTSQYVWFsvgvAKVTPVQHAINVISAVFLGPWGALEVAFIIGLLRNILGVGSLLAFPGGMVGAFIAG 86  Calda...
WP_012062496             6 LTLSGLLIAVGTISGHLIYIpigvSRIFPVQHTINVIAGVILGPLYAVGTVFGISLLRNILGTGSLLAFPGSLFGALLAA 85  Alkal...
Q893Q7                   6 LTLSALLIAIGAFLGNLIFIpigaAKCFLVQHAINVISAVILGPFYSVTIAFCISLLRNIVGTGSLLAFPGSMIGAAIAG 85  Clost...
WP_012158631             6 LTISAMFISLGVVLGNLVYIpvgiSKCFPIQHTINILSGIMLGPFYSTSIAFLISLIRNIMGIGSLLAFPGSMIGALLAG 85  Alkal...
PRJNA212797:N288_14785   7 LTAAAMMAAVGTLSGSMLYIplgfTKVFPVQHLLNVLSAVLLGPYYTVAQALCISLLRNLMGTGSVFAFPGSMAGALLAA 86  Bacil...
Q67T50                  87 LLYRRTGSRLAAMIGEVIGTGLIGAVAAYPVAVLLLGnAKAAAggiGFYIPSFAASSAAGALIGGQALAVLQR 159 Symbiobacter...
Q8CZ02                  87 LFYKYGRKFHYSALGEILGTGIIGSIVSYPVMVLFTG-SAAKLs-wFIYTPRFFGATLIGTAISFIAFRFLIK 157 Streptococcu...
Q03XM9                  86 ILYKYGRNMYWSMFGEFLGTGIVGSLISVPVMVWFTG-QQQNLy-wFVYTPRFVGATIIGSVIAYFVLVNLLK 156 Leuconostoc ...
Q830K3                  85 LFYQWGQKLGWSMLGEIFGTGIIGSLLSYPVMVWFTG-SKQNFy-wFIYTPRFIGATLIGSVIAWLVLVKLKE 155 Enterococcus...
Q8ESY9                  87 ILYRKWRRHRLAVTGEILGTGIVGSLLAVPFANFLMG-SSVGA---LAFLPAFIVSSVSGACIGWFILSRVHH 155 Oceanobacill...
Q8R987                  87 YLYRFTRKFYFASIGEVIGTGIIGALLSYPIAKYILG-SSGAA---FMFVIPFSLSSTIGSVIGYVVVLVLAK 155 Caldanaeroba...
WP_012062496            86 LCFRYTGKYTIATLGEIIGTGFIGGLVAYPIAKFLLG-SEVAL---FFFVPPFLLSTLFGGTIGYIILKLVAK 154 Alkaliphilus...
Q893Q7                  86 VLCKKTGKEFLAVIGEIFGTGLIGGSLAFPIAKFILG-KEVAG---LFFIVPFSISSIGGSVIGYTIIKLIGE 154 Clostridium ...
WP_012158631            86 ILHKKTKNNYMVAIGEIFGTGIVGGLVAFPIAKYIMG-KEVLA---LFFVYPFILSTVGGAIIALIIIKAFGQ 154 Alkaliphilus...
PRJNA212797:N288_14785  87 LLYSRTKKLSMAFTGEVIGTGIIGALLSYPLATMIMG-QKAAL---FGFIPLFIFSSTAGALLGIIILAILKK 155 Bacillus inf...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap