Conserved Protein Domain Family
Salt_tol_Pase

?
pfam09506: Salt_tol_Pase 
Glucosylglycerol-phosphate phosphatase (Salt_tol_Pase)
Proteins in this family are glucosylglycerol-phosphate phosphatases, with the gene symbol stpA (Salt Tolerance Protein A). A motif characteristic of acid phosphatases is found, but otherwise this family shows little sequence similarity to other phosphatases. This enzyme acts on the glucosylglycerol phosphate, product of glucosylglycerol phosphate synthase and immediate precursor of the osmoprotectant glucosylglycerol.
Statistics
?
PSSM-Id: 401454
View PSSM: pfam09506
Aligned: 15 rows
Threshold Bit Score: 630.864
Threshold Setting Gi: 81664626
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015193458        37 NILIIQDLDGVCMGLVKDPLARVIDKKYLEATQAFAGHFFVLTNGEHIGKRGVNLIVEKAFgNPDLIKEKGLYLPGLAGG 116 Stanieria...
jgi:Psefu_2948      41 NLLIIQDLDGVCMDLVRDPLTRTLDPAYLQAARDLDGHFQVLTNGEHIGSRGVNHLVEQALgSTQRCREQGLYLPGLAAG 120 Pseudomon...
Q46LQ7              19 NILIVQDLDGVCIPLVQDPLQREINKEYVKDVSKLREKFAVLTCGEHEGKRGVNRLVEKALdSKTTAKENGLYLPGLAAC 98  Prochloro...
Q7VCE4              19 KLLIVQDIDGVCIPLFKDPLDRKIDKDYVKTVSNLRNEFYVLTCGEHEGKRGVNRIIEKAFdSKGYVGNKGLYLPGLAAC 98  Prochloro...
Q7V791              18 DLLIVQDLDGVCIPLVKDPLTRVLDPAYVWAAKSLEGSFSVLTNGEHGGHRGVNCVVERALgDPQLPAKQGLYLPGLAAG 97  Prochloro...
CAK23824            18 DLLIVQDLDGVCMPLVKDPLTRRMPADYVRAAATLKGRFQVLTNGEHEGRRGVNRLVEAALgDTETAAREGLYLPGLAAG 97  Synechoco...
jgi:PCC7418_2274    46 NILIIQDLDGVCMGLVKDPLNRTIDPNYVRATKAFAGHFYVLTNGEHIGKRGVNPIIDRAFgDANFVKENALYLPGFGAG 125 Halothece...
wustl:cce_3291      29 NLLIIQDLDGVCMGLVKDPLTRVMDSNYIEATRSFNGHFYVLTNGEHIGKRGVNLIIERAYgDPNLVKEKGFYLPGLAGG 108 Crocospha...
jgi:Cyan10605_0416  27 NKLIIQDLDGVCMGLVKNPLHRVIDFNYVKAARNLHNHFYVLTNGEHIGKFGVNHIIEKSApNPEIVKKEGYYLSGLAGG 106 Cyanobact...
jgi:Cyast_0327      25 NSLIIQDLDGVCMGLVKDPLNRVIQWNYVQAVKKMNSHFFVLTNGEHIGKRGVNNIVEKSAsSTQEVKEKGYYLPGLAGG 104 Cyanobact...
WP_015193458       117 GVQWQDCYGNVSHPGVSSAELAFLAEVPQQIEAYLQQILPDEPYnlAASQIDKLIQATVLDNPVSPTVNLNIFYEVLRKE 196 Stanieria...
jgi:Psefu_2948     121 GVQLQDRHGRIAHPGVSADELAFLAAAPAWLSQSLKTLLQQAPYhlADGDIERLLASSVLDNPVSPTLNLNAFHHHWQGQ 200 Pseudomon...
Q46LQ7              99 GVEYQDRFSNSSYPGLKDNEINFLAEVPKMMSSMLTNELKKFLPnlSNEKRNKLIDVAVCDTRFTPTLNFNEIFSYVKND 178 Prochloro...
Q7VCE4              99 GIEFQDNFGNIELLGVEKREIQFINEVPILMKELLAKELREILKslSEQEIEDQVNIAVCDTRYSPAINLNSLFNIFKHS 178 Prochloro...
Q7V791              98 GVQLQNCYGEISHPGISDAEIAFLAALPSRMKTLLEQRLPALLPqiTSDEIQTLAKMSVLDTELSPTILLNGLFSLSPDD 177 Prochloro...
CAK23824            98 GVQLQDCYGHLTHPGVSDAEMTFLANVPTRMQGLLAERLPSVMPelGNEAIAAEIERAILDTQVSPTINLNSLFSLIPND 177 Synechoco...
jgi:PCC7418_2274   126 GVQWQDRAGKVSHPGVTDQELAFLSQVPQRIQQQLEQFFQAQLTplSPTEIKEGIEASILDNIASPTANLNTLYDKLKTK 205 Halothece...
wustl:cce_3291     109 GVQWQDCHGEVSHPGVSDKELDFLARVPQYIEGSFKDFFANNNPnlDDTAIANYIQASILDNKVSPTANLNVFHEVFIEE 188 Crocospha...
jgi:Cyan10605_0416 107 GVQWQDNYGKITYPGVKQEELTFLSAIPAIFEERLRNFCQNQAPflTKEVINEALDAVILVNQVSPTINLNTFFSLFVDH 186 Cyanobact...
jgi:Cyast_0327     105 GVQWQDCFGNVQHPGISDHELKFLANVPNIVKEKLTTFCKKKCSffSSEEINQIINAVILDNFVSPTVNINTFYEKLTAH 184 Cyanobact...
WP_015193458       197 TESYRQLQQEIQRLLEKLLQKAQQKALENSFFVHYAPNLGRDAQGQERIELAQGQNSGTTDFQFMLRGAIKEVGVLVILN 276 Stanieria...
jgi:Psefu_2948     201 PDLYARLQTDGAALLQQLLDKAAAQGLAQSFFVHYAPNLGRGAGGRERLRPAQGAAAGTTDLQLMLRGAVKEAGVLVILN 280 Pseudomon...
Q46LQ7             179 FQKVKDLQLIMGKIMNNLLEESKNLGLDNSFYLHLMPNLGI-RDGREIMKYSTQNEFGTTDIQFIIKGAIKEAGLLFLLN 257 Prochloro...
Q7VCE4             179 VLKKIELQKAIHRVMLKIKEIASSRELKDSFYLHISPNLGK-ENGLELIKYATKYDIGTTDIQFIINGALKEAGLLVLIN 257 Prochloro...
Q7V791             178 VGIQQSLQIMLHELMNELMNSAISAGLPNSFFLHIAPNMGCDGQ-RERLKPAAPGDVGTTDIQFMLKGAVKEAGLVVLIN 256 Prochloro...
CAK23824           178 VARQRQLQVMLQELMDQLMAMAAAEGLANSFFLHVAPNLGRDQEGVERLKPAEAGDVGSTDIQFMLRGAIKEVGLLVLIN 257 Synechoco...
jgi:PCC7418_2274   206 PEVYAALQATMQKLMETLLKEAAAAGLKDSFFVHYAPNLGRDQQGKEIMRPVAENDSGTTDFQFMIRGAIKEAGVLAILN 285 Halothece...
wustl:cce_3291     189 EDYYFQLQQHIKQLMDDLLAKAGNEGLEDSFFIHYAPNLGRDEKGQEIMQEAKGKDSGTTDFQFMLKGGIKEVGVLGILN 268 Crocospha...
jgi:Cyan10605_0416 187 PHLYLALQKEIKALMDELLDKAQKNGLKHSFFLHLAPNLGRDEEGVEIMKEATENDSGTTDFQFMLKGAVKEAGVLYILN 266 Cyanobact...
jgi:Cyast_0327     185 NAIYIQLQNEVKLLMDELLNQAEKEGLKDSFFVHYAPNLGRDDDGLEILRPATETDSGTTDFQFMVTGGIKEAGVLFLLN 264 Cyanobact...
WP_015193458       277 HYYYGQTGSYPLGKDFNARQAPRSQQALLDLIKDNFDPEIMPTIVGVGDTVTSKAEENN-GQLEFCRGGSDRGFLELIQA 355 Stanieria...
jgi:Psefu_2948     281 RYYGQRTGIYPLGDEFNVRQAPTSLQGLLQLAVERFEPQHMPRLVGVGDTLTSTAVTADdGSIQWLRGGSDRGFLTLVQQ 360 Pseudomon...
Q46LQ7             258 KYIANKTGVYPFGENFNVRNAPKTHAQLIKLCRDKIPHEQMPLLVGVGDTVTSVKDNKD-NS--WLRGGSDRGFLTLIQR 334 Prochloro...
Q7VCE4             258 KYILNKNGYCPFGENFNVREAPKSVKGLITLCKENITYDEMPILVGVGDTVTSNKHNTS-GK--WLRGGSDRGFLTLIQK 334 Prochloro...
Q7V791             257 KHIAKHKGRAPLGKDFDVRSAPKTHQGLLDLCRKHIPVDQMPLLMGVGDTVTSNPSPDGtG---WLRGGSDRGFLTLLQN 333 Prochloro...
CAK23824           258 RHIADRTGTAPLGDDFNVRTAPHDHGALLALCHEHIAQDQMPHLVGVGDTVTSTPCPSGdG---WLRGGSDRGFLTLLQE 334 Synechoco...
jgi:PCC7418_2274   286 RYYYQRTGNYPLGETFNVRNAPNYYSDLYQLVTNHFDPELMPIMIGVGDTVNSSVTENN-GQLEAKRGGSDRAFLQLIQE 364 Halothece...
wustl:cce_3291     269 RYYYQRTGNYPLGEDFSVRNAPRNHHQLVALIKDNFDPEQMPTIVGVGDTVTSKAVKNN-GKLSFGRGGSDRGFLQLIQE 347 Crocospha...
jgi:Cyan10605_0416 267 HYYYLHTGEYPLGQDFSPQQAPNNHQELVNLVIDKFSPESMPLIMGVGDTVNSQVTWQN-GKKIVKRGGSDRNFLQLIQD 345 Cyanobact...
jgi:Cyast_0327     265 YYYYLHTGEYPLGKDFNVRKAPKTQEELLNLVVNNFDPQKMPFIMGVGDTVNSTVMEQN-GKKIVRRGGSDRNFLQLIQN 343 Cyanobact...
WP_015193458       356 IGREFQTENVTVYVDSSHGEVKNRKPLKLEswtnHDSGapQtewRIIEGpgdHRDTEDPLRLNVVFPGGYQQYLNFFQTA 435 Stanieria...
jgi:Psefu_2948     361 LGEAFGQNNRVLYIDSSRGEV-QRPGVDAD----SLRAhpNepwPALAG---ITDAEDPLRLNALFAGGPRQYVEFFCAL 432 Pseudomon...
Q46LQ7             335 LGESYKKDNQVVFVNSCNEQV-LRPRINGT---------------DMKG---VSDPNDDLKFNMIINDGPKEYIKWFKQL 395 Prochloro...
Q7VCE4             335 LGMEYKKQNKLIFVDSSHGEV-YRPSTRDG---------------TLNG---ITDDNDDLNFDLIMKGGPIEYKAWLKEF 395 Prochloro...
Q7V791             334 LGATYNRTNRVVLVDSSGGEV-YRPSLADE---------------RLQG---ISDPEDPLHFDVLVPSGPSTYVAWFRSL 394 Prochloro...
CAK23824           335 LGESYGHCNRVVLVDSSAGEV-DRPSLLDG---------------SLEG---ISDPNDSLRFDVCIPEGPERYVNWFIAL 395 Synechoco...
jgi:PCC7418_2274   365 I----HPHNIVVYIDSSDGEVKNRKPVRIEn---TPTGe-K---RVTELptdPRDTTDPLTLNVIFPEGHSEYTAFFRKV 433 Halothece...
wustl:cce_3291     348 IGQEFNTGNLIVYIDSSAGEVKNRKPLKLE----ENNG--Qt--YVIEGpgdPRDEDDPLTLNIAFPGGYQQYINCFQAA 419 Crocospha...
jgi:Cyan10605_0416 346 IGKGFNIDNIIAYVDSSGGEVKNRKPIKVE----NIDG--Nl--IVTEGiahPDDPDEPLNVNFVFPEGHRQYCQFFQKI 417 Cyanobact...
jgi:Cyast_0327     344 IGDKLNIDNAVVYIDSSGGEIKNRKPIKLG----KNEG--Kt--IVLEGpgdNEDHNEPLKLNVVFPQGHQQYCQFFTDV 415 Cyanobact...
WP_015193458       436 A 436 Stanieria cyanosphaera
jgi:Psefu_2948     433 A 433 Pseudomonas fulva 12-X
Q46LQ7             396 A 396 Prochlorococcus marinus str. NATL2A
Q7VCE4             396 A 396 Prochlorococcus marinus
Q7V791             395 A 395 Prochlorococcus marinus str. MIT 9313
CAK23824           396 A 396 Synechococcus sp. WH 7803
jgi:PCC7418_2274   434 A 434 Halothece sp. PCC 7418
wustl:cce_3291     420 A 420 Crocosphaera subtropica ATCC 51142
jgi:Cyan10605_0416 418 t 418 Cyanobacterium aponinum PCC 10605
jgi:Cyast_0327     416 A 416 Cyanobacterium stanieri PCC 7202
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap