Conserved Protein Domain Family
YiiD_C

?
pfam09500: YiiD_C 
Putative thioesterase (yiiD_Cterm)
This entry consists of a broadly distributed uncharacterized domain often found as a standalone protein. The member from Shewanella oneidensis is described from crystallography work as a putative thioesterase because it belongs to the HotDog clan of enzymes. About half of the members of this family are fused to an Acetyltransf_1 domain pfam00583.
Statistics
?
PSSM-Id: 401451
View PSSM: pfam09500
Aligned: 25 rows
Threshold Bit Score: 167.797
Threshold Setting Gi: 122368465
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4KJY8              5 SRYLESILHHDIPLTRDMGLQVLDWQGQELRLHLPLEANVNHKSTMFGGSLYCGAVLAGWGWLHLRLKEQGIDdGHIVIQ 84  Pseudomona...
Q8KF72              2 ERKLQEILDSAIPLTQAMGIVVERYTGRELTIIAPLANNFNHLGTAFGGSLYIACVLSAWGLLYLRLREAGIK-GSIVIR 80  Chlorobacu...
Q2SMS7              7 AAQLQRIFDDEIPLTRAMALRVDQYDGQALALSAPLANNINDKATAFGGSLYSMCVLSGWGLLTLTLKSHDLK-GDIVIQ 85  Hahella ch...
Q1QXU8             16 LGGFLAWLREAIPQVTHYGIHSPAWDATTLHWKVALDANLNDKGTGFGGALAGETTLLGWCWTTLWLRARGRA-QDVVIA 94  Chromohalo...
Q0VR67              4 LAALAEQVRDAIPLTRHLDFQLTSFDGQTLTVTAPLALNHNDKGTFFAGSQSALLTLSGWALTTLLARQAGAN-ADVVAV 82  Alcanivora...
Q65QQ1              2 MQTIDQFIAQYIPAAYALNLRVVESSPQRVVIKAPFECNSNHHHTIFGGSQALLATLSAWSLVYLNFPEAN---GNIVIR 78  [Mannheimi...
mgcchina:PST_0320  20 SRYLEAILHHDIPLTRSLGLRVEQWENHELRLQVPLQPNINHKSSMFGGSLYCAAVLAGWGWLHLRLREAGIEdGHIVIH 99  Pseudomona...
WP_014870935        4 lAQFQKRINQQIPLTKALGLKLLEWDGTALLLSAPLAPNSNHQGTGFGGSLYGVGVSAAWSVAELALADLQLK-GTVVVQ 82  Marinobact...
Q2IJU8              3 HDEITAYLHEHIPITQALGARVEAWDGSAIRLSAPLAPNLNHRGTAFGGSLSALAILAGWAVLHLALRERGLE-VRLVIQ 81  Anaeromyxo...
Q8YKV8              3 SLQVEQYLHQNIPISQQMAVSVVSIDEKGVILAAPLLPNINHHGTVFGGSISNLAILSAWTLVYVRLQELFIN-SRIVIR 81  Nostoc sp....
Q4KJY8             85 EGQISYPLPVTGD-AVAICAAPDDKVWNKFLAMYQRYGRARLTLHTRVVNAGSAe-----dAVRFTGQYVLHR 151 Pseudomonas prote...
Q8KF72             81 KGNAEYLRPVTGD-IVATGTLPTEEEFAALIESFDRKGKAKMTICAVIEVEGKV-------AVKFEGEFAVVR 145 Chlorobaculum tep...
Q2SMS7             86 DSQIQFLKPLRDKrLTVRCAFAEPRQVEEFINAYQQRGKARRELVAEILAGGET-------AVRFTGRYVALK 151 Hahella chejuensi...
Q1QXU8             95 EGQQRFLAPVTTD-YHMQCFPLEADGIARLEASLAEKERGRIKLVQRVYCGDTL-------CMEAQGSYAVLK 159 Chromohalobacter ...
Q0VR67             83 KTDLEYLLPLHSD-IHITATVS-NEARSQFEQRLERRGKATLRILAHGTSANSAr------VCEYQGLYLARI 147 Alcanivorax borku...
Q65QQ1             79 SSQIRYLKPAPSD-IIAVSICPDSLAMNLAKQMLTQKGKAKITIQCQLYCDDII-------VSEWTGEFVLSH 143 [Mannheimia] succ...
mgcchina:PST_0320 100 EGKIEYPLPVVDD-AMAICSAPSPEAWERFESIYRRRGRSRLELHSRILASDGRd------AVRFTGQFVLHK 165 Pseudomonas stutz...
WP_014870935       83 TGTIEYKSPVDGD-FFSVCRLPDGEMPDHFRKSLARHGRARLELAAEIFCGVPTmqpqqepAAVFRGRFVVSn 154 Marinobacter sp. ...
Q2IJU8             82 RSALDFLEPIEGD-FTASARLPAPAQWDRFLSTLARHSRARITVEGEVACGGRA-------GGRHEGVYVALR 146 Anaeromyxobacter ...
Q8YKV8             82 RNTVDYFQPLQGD-FQAHCIAPVEDSWSSFVTNLDEKGKGRIILDAEITSSGIC-------AAKFQGEYVALI 146 Nostoc sp. PCC 7120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap