6DUZ


Conserved Protein Domain Family
PrgH

?
pfam09480: PrgH 
Click on image for an interactive view with Cn3D
Type III secretion system protein PrgH-EprH (PrgH)
In Salmonella, the gene encoding this protein is part of a four-gene operon PrgHIJK, while in other organisms it is found in type III secretion operons. PrgH has been shown to be required for type III secretion and is a structural component of the needle complex, which is the core component of type III secretion systems.
Statistics
?
PSSM-Id: 401435
View PSSM: pfam09480
Aligned: 9 rows
Threshold Bit Score: 395.976
Threshold Setting Gi: 123560678
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6DUZ_G          16 IVRLLNSSLNGCEFPLLTGRTLFV-VGQSDALTASGQLP--------DIPADSFFIPLDHGGVNFEIQVDTDATe----- 81  Salmonella en...
WP_015873672    16 IIRLLNGVLKGYEFELGKGKTLFV-AGKEEAILKKENEA--------KLPENTIFIPFDVEEFQFEIEVDSSNK------ 80  Candidatus Ha...
Q63K19          12 QLRILFGPLFGSDIAILSGEVFFC-VGEQVIDDRPAEHPenraghllERAVDTLYIPHRAGAPNFRLRFPGAPTqaarta 90  Burkholderia ...
Q7NVC0          13 VVRLLNSPLRGCEFTLQPGKTLFL-VGPESALAADGLPP--------ELPADSLFVPLAEGGVNFELLLDNGC------- 76  Chromobacteri...
utah:Sant_0599  17 VLRLLNGSLKGCEYFLSAPITLFV-AGGEGQTGPRHEPP--------SLPPETIFIPRHQGGVNFEIVIATAAPh----- 82  Sodalis praec...
Q2NR71          17 VLRLLNGLLKGCEYRLNAPVTLFV-ASDAAQAERRHEPP--------FLPPETIFIPHLQGGVNFEIVIDFVAPh----- 82  Sodalis gloss...
Q326S1          15 LVKLTNGV--GDEFPLYYGNNLIV-LGRTIETLEFGND---------NFPENIIPVTDS--------------------- 61  Shigella dyse...
Q2NVJ1          18 TLKILFGPMYGSDLILPPNTYSII-IGRSQALMIDAQGDeqg--hacHFAHNTLFIPYDARHVNIALHLPAIQEtgae-- 92  Sodalis gloss...
CBA15994        40 ELRILFGPMYGVDLLLPKQESIFVfVGAETAKSQSAS----------QFASNALVIPHHKSGINFRISFDAHIShsdian 109 Xanthomonas a...
6DUZ_G          82 ----------------------------IILHELKEGNSESRSVQLNTPIQVGE-------------------LLILIRP 114 Salmonella en...
WP_015873672    81 ----------------------------ILLREFIHHASKEKTIDFNHIVSVET-------------------LNFAIKA 113 Candidatus Ha...
Q63K19          91 et-------------------geaapgdFEVDFLSADGCVTQRAAFNTVCRFGD-------------------LAFALRR 132 Burkholderia ...
Q7NVC0          77 ----------------------------ARLRIL-GDEVTESEAPFNQPLSVGA-------------------LRLALRP 108 Chromobacteri...
utah:Sant_0599  83 ---------------------------kSVLRVLKDDGIRETPLVANRVLTAGP-------------------QALAVRA 116 Sodalis praec...
Q2NR71          83 ---------------------------kSALRVLVDGGISETPLVTNRVLTAGP-------------------QALVVRP 116 Sodalis gloss...
Q326S1          62 ----------------------------------KSDGIIYLTISKDNICQFSDekgeqidinsqfnsfeydgISFHLKN 107 Shigella dyse...
Q2NVJ1          93 ------------------------eqndFILEINNPEAPQQRRVTHNAVFSDGD-------------------IHFAVKR 129 Sodalis gloss...
CBA15994       110 kddplfdmemssqrstdhdrdvnddllrFSVEWIKGNEVTVEEGVLNSICQFED-------------------IAFAIRL 170 Xanthomonas a...
6DUZ_G         115 ESEPW-VPEQPEKLETSakKNEPr------------------FKNGIVAALAGFFILGIGTVGTLWILNSP--------- 166 Salmonella en...
WP_015873672   114 INTEW-DEAILTGKKKEmaVSKQ-------------------SKKSFVRLLMTLLISGFVVGLIFFMLSHFkttdeekke 173 Candidatus Ha...
Q63K19         133 QREPW-SEAVMHYAPHA--PSRAadaaepgap--gepgdggeRASRFALKLGALLVAGVALAALAYWQVQRyv------- 200 Burkholderia ...
Q7NVC0         109 QHLPW-QAEILNGFEPTgaPAAPssa-------------tpgRAGRALLALGALCAVALLAAGGHWLWNSQ--------- 165 Chromobacteri...
utah:Sant_0599 117 AAAAW-DAAILDYCETPtpVAPAr------------------WRRRGVLALMSLIAL---LGAGYLLRYDIvt------- 167 Sodalis praec...
Q2NR71         117 AAAAW-DDTILNFQEMPapAMTTq------------------RRRRGSMVLLSLMVL---VGAGYLLQNYAip------- 167 Sodalis gloss...
Q326S1         108 MREDKsRGHILNGMYKN-------------------------PSVFFFFAVIVVLIIIFSLSLK---------------- 146 Shigella dyse...
Q2NVJ1         130 ANEEW-HPDISDFKQPNanPTPVgdggaa--------wdklrKRRVLVAGILAVFMLLIAYVIGVRYYRT---------- 190 Sodalis gloss...
CBA15994       171 NNTPW-SDAVRQFLIKSt-DENAaetsevtadllvpsgmgqrTRRFTALACIAVALLALPLRSLISFFAD---------- 238 Xanthomonas a...
6DUZ_G         167 ---QRQAAELDSLLGQEKERFQVLPGRDKM-LYVAAQNERDTLWARQVLARGDYDKNARVINENEENKRISIWLDTYypQ 242 Salmonella en...
WP_015873672   174 kekTKEISQISYVLGDYQGKYEILGAHDHW-MYVFAKNEKEATWARQSLTRADIKNPIRVINLQDEEKRVAAWLSENwsW 252 Candidatus Ha...
Q63K19         201 --gAQKLASVNGVLAGAPVPNAILPGDDGR-IYVLSASQDGAEWDREALLKAALPEKIEVAVIGAERQRVERRLDEA--G 275 Burkholderia ...
Q7NVC0         166 ---QRQVAELSALLGDDGQRFHVLPGRDGV-YYVAAADARDGVWARQSLLRAEFRQPVQIVEPAGESERVSRWLSESrpE 241 Chromobacteri...
utah:Sant_0599 168 --gHEDVATLGRHLAGDNGKFHLLPGKDGS-LYMLADSERDAAWGRQSLVRHTSAAAVKVLSCNDERRRVHAWLERYypW 244 Sodalis praec...
Q2NR71         168 --gHEDAAALGKQLTGAQGKFHLLPGKDGS-LYMLASSERDAALGRQSLVRHPTAA-VKVVSCDDERRRVHEWLGRYypW 243 Sodalis gloss...
Q326S1         147 ---KDEVKEIAEIIDDNRYGIV----NTGQcNYILAETQNDAVWASVALNKTGFTKCRYILVSNKEINRIQQYINQRfpY 219 Shigella dyse...
Q2NVJ1         191 ---SHQIISLTAALAGSPSPVMLLQGSDGK-IYALASHYRDLQWLNAALAKRPNTAEVVPLWLTQTAQDITSRLRLE--G 264 Sodalis gloss...
CBA15994       239 ---HARTKQLAAVFDTDTARNDLIT-RDGK-VYVIAKTQSDLEWDKQIALRFPAAQRPLVTSVDDLREKSEQVLDQH--N 311 Xanthomonas a...
6DUZ_G         243 LAYYRIHF-DEPRKPVFWLsrqRNTMSKKELEVLSQK---LRALMPYADSVNITLMDDVTAAGQAEAGLKQQALPYSRRN 318 Salmonella en...
WP_015873672   253 VKYHRVKI-ETPLVPVLLIsqeRTVLDAQKSLNLMQS---LKEQMPYAKEIKIIDISDQEVASQAEAGIQKISVPYIRQD 328 Candidatus Ha...
Q63K19         276 VDFVTVRL-DAPEHPELIL---TGAAPAAARARAIGE---LRRAAPYVRDVRVIDASLGAIEQEARNALDKVGARYRLLA 348 Burkholderia ...
Q7NVC0         242 LAFYRLLL-DDPRRPQLWIsrqRSPLDEASRQKLASQ---LSVLMPYAERVSIVPVDDEAASRQAEEGLSRQALPFTRND 317 Chromobacteri...
utah:Sant_0599 245 LGFHRIHI-DDPSAPELILsrqRAVLSPAEQDRLSEA---LLEMLPYARQISFGQLDDDAVVRDAENGLRQLAIGYQRVD 320 Sodalis praec...
Q2NR71         244 LGLHRIHI-DDPSAPQLILsrqRAVLSPAERERLSAA---LLDILPYARQISFGHLDDDAVASDAENGLRQLAIGYARVD 319 Sodalis gloss...
Q326S1         220 INLYVLNLvSDKAELLVFLskeRNSSKDTELDKLKNA---LIVEFPYIKNIKFNYLSDHNARGDAKGIFTKVNVQYKEIC 296 Shigella dyse...
Q2NVJ1         265 VPVLRLDM-THPASPVLLVle---dMTQAKQNALRKK---LLPMLPYAKTLNFRSFSKNFLVQQAKQGLNRMHIVYRQVA 337 Sodalis gloss...
CBA15994       312 IDYFTILF-RNIDEPELILvahQGEDEETVKKRIAEItrlLKGVLPFAKGLHIREKTLSNVAGIAGSKLTHIPVTYSRIE 390 Xanthomonas a...
6DUZ_G         319 HKGGVTFVIQGALDDVEILRARQFVDSYYRTWGGRYVQFAIELKDDWLKGRSFQYGAEG-YIKMSPGHWYF 388 Salmonella enterica su...
WP_015873672   329 HGNSVTFVIKGALEDGHIQQLRRFVVNYNKAWGQQYVQFSIELQDDWLKGKSLKYGHQGsYVKVSPGYWYF 399 Candidatus Hamiltonell...
Q63K19         349 RRGGATFEVASSFGDEELAALQNLMRSFGHKWGTRRVDFKIALRTDWLKGKSYREGGDG-YVLLDHASWYF 418 Burkholderia pseudomallei
Q7NVC0         318 QRDSVTFVIAGALDDGELQRARQFVDAYYRQWGGRYVQFAIELKDDWLKGKSFKYGSQG-YVKLNSGHWYF 387 Chromobacterium violaceum
utah:Sant_0599 321 HPNSVTFVINGALEDGERQRIRRYVEAFQQRWSSNYVQFAVDLKDDPLAGKSFSYGQQN-FVKPNAGHWHF 390 Sodalis praecaptivus
Q2NR71         320 HPDSVTFVINGALEDGERQRIRRYLEAFKQRWSSNYVQFTVELRDDPIAGKSFSYGQQN-FVKPNAGHWYF 389 Sodalis glossinidius s...
Q326S1         297 ENNKVTYSVREELTDEKLELINRLISEHKNIYGDQYIEFSVLLIDDDFKGKSYLNSKDS-YVMLNDKHWFF 366 Shigella dysenteriae S...
Q2NVJ1         338 TPFGFSFLIHDQLNDNTMAELQGFMEIYYSQWGSDFITFSINLDENWLRDKSYLAAPNG-YVFVNQHNWYF 407 Sodalis glossinidius s...
CBA15994       391 SGGYITFFINGYITDYALSEVSDLVKGFSHDWGQRKVRFGLVLNTTWLDGKSRQVGEDG-YVLVDPSHWYF 460 Xanthomonas albilinean...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap