2UWJ,2P58


Conserved Protein Domain Family
Type_III_YscG

?
pfam09477: Type_III_YscG 
Click on image for an interactive view with Cn3D
Bacterial type II secretion system chaperone protein (type_III_yscG)
YscG is a molecular chaperone for YscE, where both are part of the type III secretion system that in Yersinia is designated Ysc (Yersinia secretion). The secretion system delivers effector proteins, designated Yops (Yersinia outer proteins), in Yersinia. This entry consists of YscG from Yersinia and functionally equivalent type III secretion proteins in other species: e.g. AscG in Aeromonas and LscG in Photorhabdus luminescens.
Statistics
?
PSSM-Id: 401433
View PSSM: pfam09477
Aligned: 4 rows
Threshold Bit Score: 140.023
Threshold Setting Gi: 81727587
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2UWJ_G   1 MDTSLIRELAELALAGSGQHCHEEALCIAEWLERLGQD-EAARLIRISSLANQGRYQEALAFAHGN--PWPALEPWFALC 77  Pseudomonas aeruginos...
Q87P25   1 MERELRQLLAEIALMATGMHRHQEANTIADCLEETSNSeEVVVMIRAMSLMNKGAYEEAHRLLEPLctAYPDLISLAALA 80  Vibrio parahaemolyticus
Q7N0U7   1 MTRSLKGLLADIALVGSGHHCHDEANIIADWLMSGEEEqEAANLIRLSSLTNQGKYQQALDFGRDL--PWPSLEPWLALC 78  Photorhabdus laumondi...
2P58_C   2 xKYKLNVLLAEIALIGTGNHYHEEANCIAEWLHLKGEE-EAVQLIRLSSLXNRGDYASALQQGNKL--AYPDLEPWLALC 78  Yersinia pestis
2UWJ_G  78 EWHLGLGAALDrRLAGLGGSSDPALADFAAGMRAQVRT 115 Pseudomonas aeruginosa CHA
Q87P25  81 AAKAGLLSQAE-RWMELAAQGSEESQAFAASFTQDIRN 117 Vibrio parahaemolyticus
Q7N0U7  79 EWRLGLASALEqRLTRMAGSDDPQLLSFVDGMREQL-A 115 Photorhabdus laumondii subsp. laumondii
2P58_C  79 EYRLGLGSALEsRLNRLARSQDPRIQTFVNGXREQLKT 116 Yersinia pestis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap