2F8V


Conserved Protein Domain Family
Telethonin

?
pfam09470: Telethonin 
Telethonin protein
Telethonin is a 167-residue protein which complexes with the large muscle protein, titin. The very N-terminus of titin, composed of two immunoglobulin-like (Ig) domains, referred to as Z1 and Z2, interacts with the N-terminal region (residues 1-53) of telethonin, mediating the antiparallel assembly of two Z1Z2 domains. The C-terminus of the telethonin appears to induce dimerization of this 2:1 titin/telethonin structure which thus forms a complex necessary for myofibril assembly and maintenance of the intact Z-disk of skeletal and cardiac muscles.
Statistics
?
PSSM-Id: 401428
View PSSM: pfam09470
Aligned: 10 rows
Threshold Bit Score: 231.596
Threshold Setting Gi: 110591359
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2F8V_T        17 RREAFWAEWKDLTLSTRPEEGSSLHEEDTQRHETYHQQGQSQVLVQRSPWLMMRMGILGRGLQEYQ-LPYQRVLPLPIFT 95 
XP_007239365  30 KRESYTADWHSINMKTQHEDRQSMAMSDDSRRETMSRYWQARPLTQSCPSGVRRVGTLESGVREHQlLPKRNTLPLPVFK 109 Mexican tetra
NP_001292500  30 KRESYTADWRSINMKTQPEDRQSMLMSDDSRRESLSRYWQVRPLHQACPSGVRRVGTVDTGVREHQlLPYRNSLPLPIFK 109 zebrafish
XP_006638280  30 DRESYSADWQSVRLITQPQDRQSLHAVDECRRESLTRQWEARPLVQHCPSGVLRLGTVAGGVREYQ-LPYRNTLPVPLFA 108 spotted gar
XP_003912988  17 RREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHQQGQCQALVQRSPWLVMRMGILGRGLQEYQ-LPYQRVLPLPIFT 95  olive baboon
XP_005994094  30 KRQYYTAEWQDMILSTRPEPGCNLGEVNDFRKETYKKQHQVQFVVQRSPYNIMKMGRLGEKMTEYK-LPYRNVLPVPIFK 108 coelacanth
XP_004071325  30 QKESYAADWVSVYLKTQPQDRQTMNMNDSSRRETLSRQWQARCLTQSCPSGVVRVGTVERGVKEHQlLPKRNTLPLPIFV 109 Japanese medaka
XP_003442192  30 QRESYTADWHSVSLKTQPQDRQTMNMNDTSRRETLSRQWQARSLTQKCPSGVFRVGTVERGVREHQlLPKRNTLPLPIFT 109 Nile tilapia
XP_003768312  17 RKEAFWAQWKDLTLSSRPEEGCFWLEEDSERRETYHRQGQCRALVQCSPLQVMRMGLLGHRLQEYQ-LPYARTLPLPIFT 95  Tasmanian devil
XP_002940414  28 RREHFSAEWIDTSMFSRPEESCNARDANVWRRESFRQQGQTRFLVQQSPAQVMKMGRLGQRLTQYQ-LPYQRMLPLPIFK 106 tropical clawed...
2F8V_T        96 PAKMGaTKEEReDTPIQLQELLALETAl-----GGQSVDRQEVAEITKQLPPVvPVSKP----GAl-rRSLSRSMSQEAQ 165
XP_007239365 110 PVDLG-IRLGR-GTPHTPEDFIPARTP------NGECPNKRDIQEITRDLPPV-KPTHMefakSA---RTLGRSMSQEAQ 177 Mexican tetra
NP_001292500 110 PAELG-VRLGR-GAPHTLEDLPPVRIP------DGVCPDKRAVEQITRDLPPV-KPMRMefakAP---RALGRSMSQEAQ 177 zebrafish
XP_006638280 109 PAELG-ARLGR-GSPHEEEPRPAVLS-------DGACPTKRALSDIKRDLPPItQPVRMdfakAP---RSLGRSMSQEAQ 176 spotted gar
XP_003912988  96 PAKMGaTKEEReDTPIQLQELLALETAl-----GGQCVDRQEVAEITKQLPPVvPVSk-----PGalrRSLSRSMSQEAQ 165 olive baboon
XP_005994094 109 PVNLA-TKPERaVTPEELQSMMEFERAl-----DGSCQDKRELSEIKKELPPViQPTKLeftkPEl-sRTFSRSMSQEAQ 181 coelacanth
XP_004071325 110 PTELG-IRLGR-GGPHTEEDLVPIPVP------NGLCPGKRTVDEITRDLPPV-KLATMefakSP---QVLGRSMSQEVQ 177 Japanese medaka
XP_003442192 110 PAELG-VRLGR-GAPHTLEDLQPFPTP------DGVCPSKRTVDEITRDLPPV-KPTLMefakAP---KALGRSMSQEAQ 177 Nile tilapia
XP_003768312  96 PSKVG-FKEDReATPVQLRELLALETAl-----GGQCLDRREVVEIKKELPPVvAASHPqfgkPGaprRSLSRSLSQEAQ 169 Tasmanian devil
XP_002940414 107 PADLS-TKMERiATPPQLRGMMEFERAlshpgnDGVCPDKKSLSQITKELPPVmQPVRMemmkPGl-aQSFTRSTSQEVM 184 tropical clawed...
2F8V_T       166 RG 167
XP_007239365 178 RG 179 Mexican tetra
NP_001292500 178 RG 179 zebrafish
XP_006638280 177 RG 178 spotted gar
XP_003912988 166 RG 167 olive baboon
XP_005994094 182 RG 183 coelacanth
XP_004071325 178 RG 179 Japanese medaka
XP_003442192 178 RG 179 Nile tilapia
XP_003768312 170 RG 171 Tasmanian devil
XP_002940414 185 RG 186 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap