2AYY


Conserved Protein Domain Family
RcsC

?
pfam09456: RcsC 
RcsC Alpha-Beta-Loop (ABL)
This domain is found in the C-terminus of the phospho-relay kinase RcsC between pfam00512 and pfam00072, and forms a discrete alpha/beta/loop structure.
Statistics
?
PSSM-Id: 401420
View PSSM: pfam09456
Aligned: 19 rows
Threshold Bit Score: 120.428
Threshold Setting Gi: 194683077
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2AYY_A           14 CWLAVRNASLCQFLETSLQRSGIV---VTT-YEGQEPTPEDVLITDEVVSKKWQGRAVVTFCRRHIGIPLEKAPGEWVHS 89  
WP_002439819    706 CWLDIHNGALREALGRLLTLSGMRysqVTE-EAAPQPGNDEVLITDRQAPEAWGGLGVIVFCRRHIGAPVAQSPGVWLHS 784  Shimwellia ...
WP_010618068    711 IWLDLRNDYLAAFLLRLLQQQGIQ---VAH-YQGR-AGADDVIICDHHDAPAQTVRARIRIYGEHIDMPQKTTPGQWVHS 785  Plautia sta...
WP_013203055    710 CWLELRNDDLAAFLEKLLREHGIT---VQR-LQEGCCGPDDVIVTDYDYQTQQTLRAVIRFDGSYNGAPHEQAAGRWVYG 785  Erwinia bil...
CAR43602        713 CFISIKNLYLESFVERYLSYVGLH---CQLfTEVTQVSENDFIITDHDECLDNSCQ-FIRIYEHYFEPAKKISENNWLCS 788  Proteus mir...
Q7N2M7          709 IILAIRNLYLEEFLQRFLVHHGLH---TVL-YSEQNTEGSEIIISDFPDAVISPVYAYIELSTDYIGSPEQIRENYWLHN 784  Photorhabdu...
CBJ90908        688 ILLTIYNDFMEKYLQAFLSQNHFQ---VTL-YNGEEIDGTEILISDQPNNIDIPVHGYIEISEKHIGPPKQIRKNYWLYN 763  Xenorhabdus...
Q6D7X3          708 CWLRVRNARLEAYLLALLQEQGML---AVR-YQNQIVSPDDVMISDYTSAEDIGVRAHIVMSGAHNGSAQKVSEGHWLQG 783  Pectobacter...
IEC:ABF-0017295 708 CWLQIRNAQMERYLLGLLNACGLD---ARRyEDGQLVSRDDVMIFDHVPDALPNAHACVEISGMQAGAAQEVRAGYWLYS 784  Dickeya dad...
1_pfamImport      1 CWLRMRNASLEHNALSLLQQYGLS---AAR-YSDQIVHEDDIVISDYPQATPPLSRWSVLFSHMHIGSAQESEAGRLVIS 76  
2AYY_A           90 VAAPHELPALLARIY 104 
WP_002439819    785 LALAHDVMSLLGRMY 799  Shimwellia blattae
WP_010618068    786 SATLHDLPLLLGRIY 800  Plautia stali symbiont
WP_013203055    786 TTTPHELPALLGRIY 800  Erwinia billingiae
CAR43602        789 TYKLNELIKIILQLp 803  Proteus mirabilis HI4320
Q7N2M7          785 TYHLHDLSVMIERLI 799  Photorhabdus laumondii subsp. laumondii
CBJ90908        764 TYELSELDNMLDNLl 778  Xenorhabdus nematophila ATCC 19061
Q6D7X3          784 TSTPQHLPDLLEKIY 798  Pectobacterium atrosepticum
IEC:ABF-0017295 785 TAALHELPVLLQRIY 799  Dickeya dadantii 3937
1_pfamImport     77 TAGLPDLPALLERL- 90  
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap