Conserved Protein Domain Family
THP2

?
pfam09432: THP2 
Tho complex subunit THP2
The THO complex plays a role in coupling transcription elongation to mRNA export. It is composed of subunits THP2, HPR1, THO2 and MFT1.
Statistics
?
PSSM-Id: 401405
View PSSM: pfam09432
Aligned: 14 rows
Threshold Bit Score: 162.865
Threshold Setting Gi: 255719258
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6CXV8       215 MRHLSLVANLSDDLVHKLESSDESNK--VLVNKNPLPAVLKETVKQYEEigdEQQRIENIRAKLFQYLDEIKAGRAKYAL 292 Kluyveromyces l...
XP_004179131 114 qKYINMVNRLSVDLAKQIETADIRKDk-YIVDNWLPPKEIEEILQEFTD---DDSEAVRLRARLEQYLDQLKMERVKYTL 189 Tetrapisispora ...
XP_003676082 118 LEYVNLLERLSVDLAKQVEISDPSVSk-FVLNDWNPPKGVQAILDKFAD---PSADAALLKMELVHYLDDIKMSRAKYSL 193 Naumovozyma cas...
XP_003669239 117 LEYINLLQRLSVDLVRQIEISDPNVSk-INVDGWNPPKKIQVLLDKFGE---PDADTRELKIQVQRYLDDIKMSRAKYSL 192 Naumovozyma dai...
CAR27216     116 LDYVNLLQRLSVDLAKQIEISDPEVSe-FVVDNWSPPDGMQSILEQLAN---PDKDSTHLQSQLDQYLDQIKMERAKYTI 191 Zygosaccharomyc...
XP_003682673 112 LRYVNLLERLSVDLVKEIEIADPTVTe-FVVNKWNPPKGIFEILDELAD---PATDVVAVRSRLNGYLDRIKMERAKYTI 187 Torulaspora del...
CCF58378     115 hEYVNLLERLSVDLGKQVDISDSNVTe-LVVDDWTPPSELISLLEQYNE---SSSDIELQDSKVDRYLDQLKLLRAKYAM 190 Kazachstania af...
XP_002555909 120 LEHINLIGRLSSVLTEMLP---------SELDDSTQNLELAQILEAYNTdskGSEDTDCLKEKLLDWIDSIKMEKARYSL 190 Lachancea therm...
Q75D17         4 LQHLQLVNQLSVELAYPLGRRGSEH---VTVNREGPPPELVAALAAYDAg-pDAPAAAELRAELLRYLDDIKATRARYLL 79  Eremothecium go...
XP_001647081 115 LVYINLLERLASDLFIQVEDAQFKDNevIMVDEVAAPVEVQDVLKKYIT---ESSETSVLRDELDKYLNEIKMERAELTI 191 Vanderwaltozyma...
Q6CXV8       293 ENKYILNSTLQQITKEVSEWSQRWTHIENSLFGDSPTSLKKLVQKAENIKELL 345 Kluyveromyces lactis
XP_004179131 190 ENRYTIEDKLILANKEVNRWRIEWDKLETLMFGRGPNSLKNMLQKNEQLAEKL 242 Tetrapisispora blattae CBS 6284
XP_003676082 194 ENKYSLQDKVVNLNTELNRWRKELDDIEMMMFGDGATSIKKMLANVESLRSKI 246 Naumovozyma castellii CBS 4309
XP_003669239 193 ENKYSLQEKLSEVTKAVNQWRAEWDNIEMMLFGDGSNSMKNMLANVESIKSKL 245 Naumovozyma dairenensis CBS 421
CAR27216     192 ENKYSLQETLNEVNKEVNYWRRNWNAIENLMFGDSAHSIKKMLQSIDLLRAKL 244 Zygosaccharomyces rouxii
XP_003682673 188 ENKHSLQGTLRDLNKEVSNWRKEWDSIENVMFGDGSHSMKKMLQNIDSLKSKL 240 Torulaspora delbrueckii
CCF58378     191 ENNYLLKSTLNDLNDEVNYWRREYENIESMMFGNGPNSMKKMLHNVEVLKVka 243 Kazachstania africana CBS 2517
XP_002555909 191 ENQHILRDSLKALTMEVTRWRENYESIEGMMFGENANSISQMLHKVQRLRPQL 243 Lachancea thermotolerans CBS 6340
Q75D17        80 ENKYLLADSLRQLTRDVSSWSQKWESLEGTLFGDAPSSLRSLLRSVDTTKATI 132 Eremothecium gossypii
XP_001647081 192 KNKFSLQPTLNELSKEVNYWRKEWDNMEMLMFGDGPNSMKRMMKNIESLRAKA 244 Vanderwaltozyma polyspora DSM 70294
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap