Conserved Protein Domain Family
DUF2014

?
pfam09427: DUF2014 
Domain of unknown function (DUF2014)
This domain is found at the C terminal of a family of ER membrane bound transcription factors called sterol regulatory element binding proteins (SREBP).
Statistics
?
PSSM-Id: 401400
View PSSM: pfam09427
Aligned: 43 rows
Threshold Bit Score: 257.906
Threshold Setting Gi: 74626009
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_009216333  633 KTMKLSLRNTIGV--QQYQALTGLTE-----EQETARVKAWAIALDAQLAGGDVEINKSRLTLTLLASGTLPDTPLRLML 705  Gaeumannomyce...
EFW18200      565 RCFEYLLRCLLGW--KLYSILTGISE-----DDEKGRVKAWDIALDAQLTGGDAEVSKSRLVLTIFAAGTLPRSLSRMML 637  Coccidioides ...
XP_002480172  484 RWVEYSVCCLVGR--SVYSWITGITE-----EDEKGRIKTWDIAIDAQLAGGDTEVSKSRLVLTIFASGTLPRSPARIML 556  Talaromyces s...
GAD97007      508 RCFEYCLRCLLGW--KLYSHITGITE-----EDEKGRVKTWDIAIDAQLAGGDPEISKSRLVLTIFAAGTLPRSPLRMML 580  Byssochlamys ...
EPS29683      491 RCFEYVLRCLMGW--KLYSWATGITE-----EDERGRVKTWDIAIDAQLTGGDVEISKSRLVLTIFAAGTLPRSPMRMML 563  Penicillium o...
XP_001273183  507 RCFEYVLRCLLGW--KLYSWVTGVTE-----EDERGRVKTWDIAIDAQLAGGDTEISKSRLVLTIFAAGTLPRSPMRMML 579  Aspergillus c...
XP_002837557  578 KTLKLSLRKLIGW--NGYALLTGMTE-----EHEAARIKAWSIALDAQLAGGDATITHSRLILTLLASLTLPATPSRLML 650  Tuber melanos...
CCX11038      582 KAIKLSLRRMIGW--EKYRMLTGMTE-----EQELARIKSWTIAVDAQLSGGDLSVNHSRLLLTLLASWTLPATPTRTML 654  Pyronema omph...
Q6C906        423 AMGKALLRFLIG---DGYLLLQSSSY-----HLPISR------AVEAQLCGGQENMSRADLFVTYLQTLTLPPTPALCAT 488  Yarrowia lipo...
EPY52195      522 GLLIFIVKSSINYinHRISGLYASSEtwvysEQQLADIRNLEKLLDAQLMGGDEKVNRLRLFMVFASSFFLPTTSHTSAL 601  Schizosacchar...
XP_009216333  706 KALHIRVLLWQL-GQGGIH----NVVAAKLARAKWNQAKQLHRLSKASSSprlsaqeqiPSDDSLPDHLAVLLDQ-ECDD 779  Gaeumannomyce...
EFW18200      638 KSLHCRILLWRVgSSGSIAckisDHIAGILAKYQWQLAQQMQKLTPEDHE------------DALPSHLAYLLQH-DCED 704  Coccidioides ...
XP_002480172  557 KAFHCRILLWRVgQPGSFVstvaNHVGRVLATYQWNLARELNRSLPKDHP------------DALPSHLSALVET-ECND 623  Talaromyces s...
GAD97007      581 KALHCRILLWRVgDPGTYTykvsNDVARHLANYQWQMARKMNKRLPKDHP------------DALPSHLAALLEI-DCED 647  Byssochlamys ...
EPS29683      564 KALHVRILLWRVgQSGSWTcrvsNDVARALAKYQWAVARELNDALPAGHP------------DQLPGHLSALVKL-DCED 630  Penicillium o...
XP_001273183  580 KALHCRILMWRVgEPGSWTfkvsNDVARSLARYQWDLAREMNNTLPQGHE------------DALPRHLAALLKI-DSDD 646  Aspergillus c...
XP_002837557  651 NALHIRVLFWDLgSSf-------ESFANWLANYYWLEARNVQQKSLNNTD---------SSAESLPEHLARLLDL-DPNE 713  Tuber melanos...
CCX11038      655 NALHIRLLFFGLgAAf-------QAFSESFSNYYWGEARKAQEKAVAEND----------IEQQLSENLAQLLQL-EPSD 716  Pyronema omph...
Q6C906        489 QAIHVHVLA--------NGlpwlKKASVIMADRHWKQARKLAS----------------QKKHAVPSYLSLLLAQ---ND 541  Yarrowia lipo...
EPY52195      602 QAMYSELIF--------SNspmpSAFVSKCASFFWNRAKRLQSSASMQSD-----------LQELPECVVKLIETcDAED 662  Schizosacchar...
XP_009216333  780 VLNDDVVQRAHNLAWNRPTTHDV--AADIDGMNAVVEDPAIKSPMDAVAAWWSSLVLHQVLTTSLdiatttteKGDSEQE 857  Gaeumannomyce...
EFW18200      705 VFTDAIVQRASNMIWNRPTQEAT--DGEDSLLDVVVEDSAIRSPLDAIAAWWSSRALQEALIHSLdv-----tSADCGTR 777  Coccidioides ...
XP_002480172  624 VLIDPIVQRAVNLTWSRPTQEGL--DEDEALLDVVAEDPAVQTFADSIAAWWSSHVLQTALLNSFn-------IDSDGGY 694  Talaromyces s...
GAD97007      648 VMIDPIVQRAANLTWNRPTQEAA--DDDQALLDVVVEDPAIQSSLDSLAAWWSSHILQRALLRSFea----ssAGPSAKK 721  Byssochlamys ...
EPS29683      631 VMIDSIIQRAVNLTWNRPTQEGA--TDDEVLLDVVEEDPAIQCSVDALAAWWSSHLLQNALLNYLea----seGSSTSKK 704  Penicillium o...
XP_001273183  647 VMIDSVIQRAANLTWNRPTQEGT--DDDEALLDVVEEDPAIQSSLDALAAWWSSHMLQRALLRYFev----ssGGPDVKK 720  Aspergillus c...
XP_002837557  714 VLHSKIIQKAYNLAYDRGTGENC--GGYDEGMDTVVEDESVRSPLDAVAAWYSSLVLQGVLAANL--------KTRNTEV 783  Tuber melanos...
CCX11038      717 VFDDLIVHKAFNLCYNRDAQDGL-----DEGMDSVVRDVSVRSPLDALAAWHSSLLLQQVFVSCL--------KAKSSPA 783  Pyronema omph...
Q6C906        542 VFDSDIIQRFYNFAHGLDASHGCslGMLDEGFITATSDSALKTPLDVLAAWYSTRTLREVILFQL--------------E 607  Yarrowia lipo...
EPY52195      663 IFSSWMVKRLWTLA--RCTRDSA---KLPNSIISKLSDVVVMSPLETTASWYAVDLLEALLMESL--------------- 722  Schizosacchar...
XP_009216333  858 PSTSSINedDLTLAAKVAPVGSNAQVRALVARAFLVKANRGANMVAALEAMA 909  Gaeumannomyces tritici R3-111a-1
EFW18200      778 RREAFER--NLEMALKSAPPTSAAYTRAAAIKALFFDEDRVANINSVLAALP 827  Coccidioides posadasii str. Silveira
XP_002480172  695 GKKKLEQ--QINLALQVAPRLSAAHTRAAAMRAVLYEQNRLYDIKTVLNALP 744  Talaromyces stipitatus ATCC 10500
GAD97007      722 CRGILYR--KVTTALNVAPRPSAAYTRALVMKAVFFEEDRIQNIGAVLAALP 771  Byssochlamys spectabilis No. 5
EPS29683      705 SRDIFKE--KIRMALDVAPRLSAAYTRALVMKAVFFDKDRVENVGAVLAALP 754  Penicillium oxalicum 114-2
XP_001273183  721 NRHIFKT--KIKTALDVAPQPSAAHARALVVKAVFFEQDRVVNIGKVLAVLP 770  Aspergillus clavatus NRRL 1
XP_002837557  784 IRSGITE--DLEAALNVAPPNSKAQLRTLVTKAMLEDKDDGTTLRAALKAFE 833  Tuber melanosporum Mel28
CCX11038      784 LSKRIQS--DLATALRIAPPNSAAHIRALTASAVLSEEHGQKYLNEAMQIFE 833  Pyronema omphalodes CBS 100304
Q6C906        608 ANEVDYN--KLDTAQAVSPVNSIAKRRAAIAHSVVLGRKDSNLVKDALVMVK 657  Yarrowia lipolytica
EPY52195      723 DHRIEKS--EIDKVLSLSPKNSPVYRHALVAKLVLFEDNTSESLTEVLAAYN 772  Schizosaccharomyces cryophilus OY26
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap