1NG6


Conserved Protein Domain Family
YqeY

?
pfam09424: YqeY 
Click on image for an interactive view with Cn3D
Yqey-like protein
The function of this domain found in the YqeY protein is uncertain.
Statistics
?
PSSM-Id: 401397
View PSSM: pfam09424
Aligned: 41 rows
Threshold Bit Score: 146.199
Threshold Setting Gi: 123546278
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NG6_A     4 LERLNQDMKLYMKNREKDKLTVVRMVKASLQNEAIKLKK----DsLTEDEELTVLSRELKQRKDSLQEFSNANRLDLVDK 79  Bacillus subtilis
Q6NAA7     3 RDDINNAVKEAMKAKDERKLSTLRMVNSTIKNADIEARGqgkpP-LSDGDLLSLLQKMIKQRQESVELYDKGGRAELADQ 81  Rhodopseudomonas pa...
Q2YM23     3 rQEISQALTTALKAQEKRRMSTLRLVMAAVKDRDIANRTagkdP-VGDEELLGILGKMVKQREESARIYEEGSRLELAEA 81  Brucella abortus 2308
AAK87914   3 RDTFANTLKDALKARDARRTSTVRLIQAAVKDRDIANRGvgkdP-VSDEDIMQILTKMVKQREESATIYEGAGRPELAAQ 81  Agrobacterium fabru...
Q8EHD8     4 IDQLKDHMKQAMIAKEKARLSTIRMALAAIKQIEVDTRE----S-LNDEQVIAVLTKMVKQRRDSIAQYEAAGRSELAAA 78  Shewanella oneidensis
Q6LV12     4 TERLKDEQIAAMKARNKPRLGAIRLVLAAIKQREVDERI----T-LSDEDVLAVLVKMVKQRRDSVAQYEAANRQDLADV 78  Photobacterium prof...
Q7MP01     4 IEQLKEEQKLAMKAKDKQRLGTIRLALSAIKQREVDEQI----T-LNDDDILAVLTKMVKQRRDSVTQFEAAGRQDLADA 78  Vibrio vulnificus Y...
Q9I5V9     5 KSRLLDAVKVAMRAQDKPRLTTLRLALADIKRVEVDERI----E-VDDARALLILDRMIKQRRDAQRQFSDAGRQDLAEV 79  Pseudomonas aeruginosa
Q5ZT06     4 KEQINNDIKDAMRAKDKNLLNALRLISAAVKQIEVDERI----E-VDDERMLVILDKMSKQRKESIAQFEKASRDDLVAQ 78  Legionella pneumoph...
Q72B47     4 IERLEKDYVVAYKAKDALRLGVLRLLKTAAKNLQVELRR----P-VEEAEMLDLLTKQAKQRVDSIEQFRAAGRDDLADK 78  Desulfovibrio vulga...
1NG6_A    80 VQKELDILEVYLPEQLSEEELRTIVNETIAEVGASSKADMGKVMGAIMPKVKGKADGSLINKLVSSQL 147 Bacillus subtilis
Q6NAA7    82 ERAEIAVIQAYLPQQMSDDEVKAAIAATISETGAAGIKDMGKVIGALKAKYAGQMDFGKASGMVKAAL 149 Rhodopseudomonas palustris
Q2YM23    82 EREEIAIISEFLPQQMTEDETKKACEDVITEIGAQGLRDMGKCMALLKERYAGKMDFTRASALVKSLL 149 Brucella abortus 2308
AAK87914  82 EREEIVIIKEFMPEEIPAEKVRELCQAVISETGASGLRDMGKCMNALKERYPGQIDFAKASGVVKDLL 149 Agrobacterium fabrum str. C58
Q8EHD8    79 EAEEIQVIETFLPTPLSEAEIAAFIDAAIVEIGASSMADMGKVMGALKPKVQGRADMGAIGAMIRAKL 146 Shewanella oneidensis
Q6LV12    79 ELAEIAVLDEFMPQPLSDDEVIALLDEAVASTGAVSMQDMGKLMGVLKPLIQGRADMGKVSQLVKAKL 146 Photobacterium profundum
Q7MP01    79 EKAEITVLEEFMPQPLNEDEVAALIDSAIAESGAAGMQDMGKVMAVLKPQIQGRADMGKVSGLVRAKL 146 Vibrio vulnificus YJ016
Q9I5V9    80 EAAEILVLQDFMPKPLDDHEIDALIERSIVDSGAQGPQDMGKAMNLLRPQVQGRVDMAQVSQRLKARL 147 Pseudomonas aeruginosa
Q5ZT06    79 EQFELNIISKYLPEPLTDNEIEELICDAIKSTGAEKMSDMGKVMAILKPKLQGRADMAQVSARIKAKL 146 Legionella pneumophila subsp. p...
Q72B47    79 EDAELGVIREYLPQPLTGEELSAAIESAVAASGATSMKDMGRVMSAIMDEHKGRVDGKELSSAVRARL 146 Desulfovibrio vulgaris str. Hil...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap